Продукція > OMRON > Всі товари виробника OMRON (26815) > Сторінка 410 з 447

Обрати Сторінку:   [  << Попередня Сторінка ]  1 44 88 132 176 220 264 308 352 396 405 406 407 408 409 410 411 412 413 414 415 440 447  [ Наступна Сторінка >> ]
Фото Назва Виробник Інформація Доступність Ціна без ПДВ
D2SP0242C OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 131 шт:
термін постачання 14-30 дні (днів)
53+133.10 грн
Мінімальне замовлення: 53 шт
В кошику  од. на суму  грн.
D2SP0246F OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 148 шт:
термін постачання 14-30 дні (днів)
24+289.90 грн
120+242.10 грн
Мінімальне замовлення: 24 шт
В кошику  од. на суму  грн.
D2SP0256C OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 140 шт:
термін постачання 14-30 дні (днів)
24+293.54 грн
120+245.49 грн
Мінімальне замовлення: 24 шт
В кошику  од. на суму  грн.
D4BS-45FS D4BS-45FS OMRON c094_d4bs_safety-door_switch_datasheet_en.pdf Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
товару немає в наявності
В кошику  од. на суму  грн.
D4BS-25FS D4BS-25FS OMRON c094_d4bs_safety-door_switch_datasheet_en.pdf Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: G1/2
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
товару немає в наявності
В кошику  од. на суму  грн.
D4BS-4AFS D4BS-4AFS OMRON C094-E2-04A-X%2BD4BS%2BDatasheet.pdf Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC x2; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC x2
Safety switches features: no key
Switches features: slow action contacts
товару немає в наявності
В кошику  од. на суму  грн.
D40ML-SS2-B-ACT D40ML-SS2-B-ACT OMRON Category: Standard Safety Switches
Description: Actuator; IP67; stainless steel; -25÷40°C; 600N; D40ML
Force: 600N
Application - series/manufacturer: D40ML
IP rating: IP67
Operating temperature: -25...40°C
Type of sensors accessories: actuator
Body material: stainless steel
товару немає в наявності
В кошику  од. на суму  грн.
FQ2-S30010F-08 FQ2-S30010F-08 OMRON fq2_q193-e1_14_6_csm1006918.pdf?id=3131 Category: Measurement Sensors
Description: Sensor: vision; 57mm; NPN; FQ2-S3; Resolution: 760000px
Type of sensor: vision
Range: 57mm
Output configuration: NPN
Manufacturer series: FQ2-S3
Resolution: 760000px
товару немає в наявності
В кошику  од. на суму  грн.
G3NA-250B-UTU 5-24VDC G3NA-250B-UTU 5-24VDC OMRON Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 5÷24VDC; 50A; 24÷240VAC; G3NA; 1-phase
Manufacturer series: G3NA
Body dimensions: 58x43x27mm
Type of relay: solid state
Operating temperature: -30...80°C
Max. operating current: 50A
Switched voltage: 24...240V AC
Control voltage: 5...24V DC
Relay variant: 1-phase
Related items: R99-12
Switching method: zero voltage switching
Caution!: Maximal load current with use of suitable heatsink
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+8017.77 грн
В кошику  од. на суму  грн.
E2E-X8MC312-M1 E2E-X8MC312-M1 OMRON E2A-replacement.pdf E2E-NEXT-small-EN.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; IP67
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 48mm
Max. operating current: 0.1A
Number of pins: 4
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: M12 male
Manufacturer series: E2E Next
Trade name: E2E Next
товару немає в наявності
В кошику  од. на суму  грн.
E2E-X5MC312 2M E2E-X5MC312 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷5mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...5mm
Overall length: 47mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
товару немає в наявності
В кошику  од. на суму  грн.
E2E-X8MC312 2M E2E-X8MC312 2M OMRON E2A-replacement.pdf E2E-NEXT-small-EN.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 47mm
Max. operating current: 0.1A
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
товару немає в наявності
В кошику  од. на суму  грн.
D4C-1342 OMRON Category: Limit Switches
Description: Limit switch; SPDT; cables; 5m; IP67; No.of mount.holes: 2; metal
Manufacturer series: D4C
Body material: metal
Operating temperature: -10...70°C
Mounting holes pitch: 25mm
Type of sensor: limit switch
Number of mounting holes: 2
DC contacts rating @R: 4A / 30V DC
Lead length: 5m
AC contacts rating @R: 5A / 250V AC
Connection: cables
IP rating: IP67
Resistance to: oils
Output configuration: SPDT
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 360P/R 1M E6C3-CWZ3XH 360P/R 1M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 360P/R 2M E6C3-CWZ3XH 360P/R 2M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH-3600 2M E6C3-CWZ3XH-3600 2M OMRON e6c3-c.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Switching frequency max: 125kHz
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 3600P/R 1M E6C3-CWZ3XH 3600P/R 1M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
D4N-4ARE OMRON c130d4nminiaturesafetylimitswitchdatasheeten.pdf Category: Limit Switches
Description: Limit switch; roller lever; 10A; max.240VAC; max.250VDC; M20; IP67
Operating temperature: -30...70°C
Type of sensor: limit switch
Connection: M20
Body material: plastic
Kind of actuator: roller lever
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
IP rating: IP67
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 1M E6C3-CWZ3XH 200P/R 1M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 2M E6C3-CWZ3XH 200P/R 2M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 1M E6C3-CWZ3XH 2048P/R 1M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 2M E6C3-CWZ3XH 2048P/R 2M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
3G3M1-A4015 3G3M1-A4015 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 1.5/2.2kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+53964.73 грн
В кошику  од. на суму  грн.
3G3M1-A4022 3G3M1-A4022 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+60314.21 грн
В кошику  од. на суму  грн.
3G3M1-A4040 3G3M1-A4040 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 4/5.5kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 4/5.5kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+73477.21 грн
В кошику  од. на суму  грн.
3G3M1-A2007 3G3M1-A2007 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.75/1.1kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.75/1.1kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+48546.92 грн
В кошику  од. на суму  грн.
3G3M1-A2004 3G3M1-A2004 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.4/0.75kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.4/0.75kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+39755.18 грн
В кошику  од. на суму  грн.
3G3M1-A2022 3G3M1-A2022 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+61942.38 грн
В кошику  од. на суму  грн.
3G3MX2-A4015-EV2 3G3MX2-A4015-EV2 OMRON mx2-ev2-EN.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x380÷480VAC
Manufacturer series: 3G3MX2
IP rating: IP20
Operating temperature: -10...50°C
The programming method: keypad; operator panel; PC
Electrical connection: screw terminals
Type of automation module: vector inverter
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
Number of analog inputs: 3
Voltage between phases (for three phase system): 3 x 380...480V AC
Number of inputs: 10
Max motor power: 1.5/2.2kW
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+72393.28 грн
В кошику  од. на суму  грн.
K8DS-PZ2 K8DS-PZ2 OMRON K8DS-PZ.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PZ; SPDT
Manufacturer series: K8DS-PZ
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: overvoltage; phase asymmetry; phase failure; phase sequence; undervoltage
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+11167.44 грн
В кошику  од. на суму  грн.
K8DS-PA2 K8DS-PA2 OMRON K8DS-PA.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PA; SPDT
Manufacturer series: K8DS-PA
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: phase asymmetry; phase failure; phase sequence
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+8247.50 грн
В кошику  од. на суму  грн.
S8VK-T48024 S8VK-T48024 OMRON S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 480W; 24VDC; 20A; OUT: 1
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 150x125x95mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 20A
Output voltage: 24V DC
Efficiency: 91%
Supply voltage: 450...600V DC
Power: 480W
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+28340.69 грн
В кошику  од. на суму  грн.
S8VK-T12024 S8VK-T12024 OMRON S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 120W; 24VDC; 5A; 450÷600VDC
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 122.2x104.6x40mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 5A
Output voltage: 24V DC
Efficiency: 89%
Supply voltage: 450...600V DC
Power: 0.12kW
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 9 шт:
термін постачання 14-30 дні (днів)
1+15353.64 грн
5+13693.17 грн
В кошику  од. на суму  грн.
XS2F-M12PVC4A5M XS2F-M12PVC4A5M OMRON XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M12 female; angled; Len: 5m
Connector: plug
Number of pins: 4
Max. operating voltage: 125V DC
Type of connection cable: for sensors/automation
IP rating: IP67
Wire insulation material: PVC
Operating temperature: -10...80°C
Cable external diameter: 5mm
Max. operating current: 4A
Cable length: 5m
Polarisation: A code - DeviceNet / CANopen
Connector variant: angled
Cable/adapter structure: M12 female
Manufacturer series: XS2
Insulation colour: black
на замовлення 44 шт:
термін постачання 14-30 дні (днів)
1+1500.54 грн
5+1274.00 грн
10+1253.68 грн
В кошику  од. на суму  грн.
E2V-X4B1-M1 E2V-X4B1-M1 OMRON e2v_en.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 100mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 40Hz
Overall length: 60mm
Number of pins: 3
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
1+11823.81 грн
5+10262.26 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-C1 2M E2B-M30KS15-WP-C1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
1+2696.60 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-B1 2M E2B-M30KS10-WP-B1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+2762.23 грн
В кошику  од. на суму  грн.
E2E-X15B1T30 5M E2E-X15B1T30 5M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷15mm; 10÷30VDC; M30; 5m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 5m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+4913.67 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-C1 2M E2B-M30KS10-WP-C1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
1+2826.05 грн
В кошику  од. на суму  грн.
E2E-X15B230 2M E2E-X15B230 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
Kind of forehead: embedded
IP rating: IP67
Switch housing: M30
Plating material: nickel
Output configuration: PNP / NC
Operating temperature: -25...70°C
Range: 0...15mm
Overall length: 60mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 250Hz
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+4619.22 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-B2 2M E2B-M30KS15-WP-B2 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Body material: brass
Connection: cables
Kind of forehead: embedded
IP rating: IP67
Switch housing: M30
Plating material: nickel
Output configuration: PNP / NC
Operating temperature: -25...70°C
Range: 0...15mm
Overall length: 60mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 250Hz
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+3029.34 грн
В кошику  од. на суму  грн.
E2E-X22B1T30 2M E2E-X22B1T30 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+6331.26 грн
В кошику  од. на суму  грн.
E2E-X22C130 2M E2E-X22C130 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Plating material: nickel
Manufacturer series: E2E Next
Trade name: E2E Next
Lead length: 2m
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+6234.62 грн
В кошику  од. на суму  грн.
E2E-X22B230 2M E2E-X22B230 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NC
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+5971.16 грн
В кошику  од. на суму  грн.
NX701-1700 NX701-1700 OMRON Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
NX701-Z700 NX701-Z700 OMRON Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
E2A-M12KS04-M1-B1 E2A-M12KS04-M1-B1 OMRON E2A-replacement.pdf e2a.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 200mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -40...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 1kHz
Overall length: 48mm
Plating material: nickel
Number of pins: 4
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1A-E-CV-HA-DC12 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 12VDC; Icontacts max: 16A; G2RL
Type of relay: electromagnetic
Coil voltage: 12V DC
Contact current max.: 16A
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 360Ω
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 33.3mA
Operate time: 15ms
Switched voltage: max. 440V AC
Release time: 5ms
Current rating: 16A
Relay variant: monostable; power
Operating temperature: -40...85°C
Leads: for PCB
на замовлення 28 шт:
термін постачання 14-30 дні (днів)
20+361.92 грн
Мінімальне замовлення: 20 шт
В кошику  од. на суму  грн.
E3AS-HL500MT M3 E3AS-HL500MT M3 OMRON E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+30007.14 грн
В кошику  од. на суму  грн.
E3AS-HL500LMT M3 E3AS-HL500LMT M3 OMRON E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+30501.25 грн
В кошику  од. на суму  грн.
M2DT-500GY OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; green; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: green
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500R OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; red; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: red
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500W OMRON Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; white; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: white
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500Y OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; yellow; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: yellow
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
S8FS-G15048CD S8FS-G15048CD OMRON S8FS-G-DTE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 150W; 48VDC; 3.3A; OUT: 1
Mounting: for DIN rail mounting
Kind of power supply: for DIN rail
Type of power supply: switching
Electrical connection: terminal block
Operating temperature: -20...70°C
Body dimensions: 197x97x39.2mm
Number of outputs: 1
Output current: 3.3A
Output voltage: 48V DC
Supply voltage: 80...370V DC; 100...240V AC
Efficiency: 88%
Power: 150W
Protection: anti-overload OPP; short circuit protection SCP
товару немає в наявності
В кошику  од. на суму  грн.
D4N-1132 D4N-1132 OMRON d4n.PDF Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: PG13,5
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
Switching frequency max: 2Hz
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
1+2161.47 грн
В кошику  од. на суму  грн.
D4N-4132 D4N-4132 OMRON d4n.PDF Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M20
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
Switching frequency max: 2Hz
на замовлення 11 шт:
термін постачання 14-30 дні (днів)
1+2129.56 грн
В кошику  од. на суму  грн.
D4MC-5040 D4MC-5040 OMRON d4mc.PDF Category: Limit Switches
Description: Limit switch; pusher with parallel roller; SPDT; 10A; max.250VAC
Type of sensor: limit switch
Kind of actuator: pusher with parallel roller
Output configuration: SPDT
Contact current max.: 10A
Switched voltage: max. 250V AC
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -10...80°C
Mounting holes pitch: 25.4mm
на замовлення 5 шт:
термін постачання 14-30 дні (днів)
1+3954.64 грн
5+3445.30 грн
В кошику  од. на суму  грн.
AX-GPM01-ICE OMRON Category: Three Phase Inverters
Description: Grounding plates
Type of control accessories: grounding plates
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1-E-DC24 G2RL-1-E-DC24 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VDC; SPDT; G2RL; power,monostable
Type of relay: electromagnetic
Coil voltage: 24V DC
Contacts configuration: SPDT
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 1.44kΩ
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 16.7mA
Height: 15.7mm
Operate time: 15ms
Release time: 5ms
IP rating: IP67
Current rating: 16A
Relay variant: monostable; power
Coil power consumption: 400mW
Operating temperature: -40...85°C
на замовлення 3574 шт:
термін постачання 14-30 дні (днів)
31+236.11 грн
100+204.01 грн
Мінімальне замовлення: 31 шт
В кошику  од. на суму  грн.
D2SP0242C
Виробник: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 131 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
53+133.10 грн
Мінімальне замовлення: 53 шт
В кошику  од. на суму  грн.
D2SP0246F
Виробник: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 148 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
24+289.90 грн
120+242.10 грн
Мінімальне замовлення: 24 шт
В кошику  од. на суму  грн.
D2SP0256C
Виробник: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 140 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
24+293.54 грн
120+245.49 грн
Мінімальне замовлення: 24 шт
В кошику  од. на суму  грн.
D4BS-45FS c094_d4bs_safety-door_switch_datasheet_en.pdf
D4BS-45FS
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
товару немає в наявності
В кошику  од. на суму  грн.
D4BS-25FS c094_d4bs_safety-door_switch_datasheet_en.pdf
D4BS-25FS
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: G1/2
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
товару немає в наявності
В кошику  од. на суму  грн.
D4BS-4AFS C094-E2-04A-X%2BD4BS%2BDatasheet.pdf
D4BS-4AFS
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC x2; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC x2
Safety switches features: no key
Switches features: slow action contacts
товару немає в наявності
В кошику  од. на суму  грн.
D40ML-SS2-B-ACT
D40ML-SS2-B-ACT
Виробник: OMRON
Category: Standard Safety Switches
Description: Actuator; IP67; stainless steel; -25÷40°C; 600N; D40ML
Force: 600N
Application - series/manufacturer: D40ML
IP rating: IP67
Operating temperature: -25...40°C
Type of sensors accessories: actuator
Body material: stainless steel
товару немає в наявності
В кошику  од. на суму  грн.
FQ2-S30010F-08 fq2_q193-e1_14_6_csm1006918.pdf?id=3131
FQ2-S30010F-08
Виробник: OMRON
Category: Measurement Sensors
Description: Sensor: vision; 57mm; NPN; FQ2-S3; Resolution: 760000px
Type of sensor: vision
Range: 57mm
Output configuration: NPN
Manufacturer series: FQ2-S3
Resolution: 760000px
товару немає в наявності
В кошику  од. на суму  грн.
G3NA-250B-UTU 5-24VDC
G3NA-250B-UTU 5-24VDC
Виробник: OMRON
Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 5÷24VDC; 50A; 24÷240VAC; G3NA; 1-phase
Manufacturer series: G3NA
Body dimensions: 58x43x27mm
Type of relay: solid state
Operating temperature: -30...80°C
Max. operating current: 50A
Switched voltage: 24...240V AC
Control voltage: 5...24V DC
Relay variant: 1-phase
Related items: R99-12
Switching method: zero voltage switching
Caution!: Maximal load current with use of suitable heatsink
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+8017.77 грн
В кошику  од. на суму  грн.
E2E-X8MC312-M1 E2A-replacement.pdf E2E-NEXT-small-EN.pdf
E2E-X8MC312-M1
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; IP67
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 48mm
Max. operating current: 0.1A
Number of pins: 4
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: M12 male
Manufacturer series: E2E Next
Trade name: E2E Next
товару немає в наявності
В кошику  од. на суму  грн.
E2E-X5MC312 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X5MC312 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷5mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...5mm
Overall length: 47mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
товару немає в наявності
В кошику  од. на суму  грн.
E2E-X8MC312 2M E2A-replacement.pdf E2E-NEXT-small-EN.pdf
E2E-X8MC312 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 47mm
Max. operating current: 0.1A
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
товару немає в наявності
В кошику  од. на суму  грн.
D4C-1342
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; SPDT; cables; 5m; IP67; No.of mount.holes: 2; metal
Manufacturer series: D4C
Body material: metal
Operating temperature: -10...70°C
Mounting holes pitch: 25mm
Type of sensor: limit switch
Number of mounting holes: 2
DC contacts rating @R: 4A / 30V DC
Lead length: 5m
AC contacts rating @R: 5A / 250V AC
Connection: cables
IP rating: IP67
Resistance to: oils
Output configuration: SPDT
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 360P/R 1M e6c3-c_ds_e_7_3_csm495.pdf
E6C3-CWZ3XH 360P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 360P/R 2M e6c3-c_ds_e_7_3_csm495.pdf
E6C3-CWZ3XH 360P/R 2M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH-3600 2M e6c3-c.pdf
E6C3-CWZ3XH-3600 2M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Switching frequency max: 125kHz
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 3600P/R 1M e6c3-c_ds_e_7_3_csm495.pdf
E6C3-CWZ3XH 3600P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
D4N-4ARE c130d4nminiaturesafetylimitswitchdatasheeten.pdf
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; roller lever; 10A; max.240VAC; max.250VDC; M20; IP67
Operating temperature: -30...70°C
Type of sensor: limit switch
Connection: M20
Body material: plastic
Kind of actuator: roller lever
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
IP rating: IP67
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 1M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 200P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 2M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 200P/R 2M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 1M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 2048P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 2M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 2048P/R 2M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
3G3M1-A4015 3G3M1-series.pdf
3G3M1-A4015
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 1.5/2.2kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+53964.73 грн
В кошику  од. на суму  грн.
3G3M1-A4022 3G3M1-series.pdf
3G3M1-A4022
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+60314.21 грн
В кошику  од. на суму  грн.
3G3M1-A4040 3G3M1-series.pdf
3G3M1-A4040
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 4/5.5kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 4/5.5kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+73477.21 грн
В кошику  од. на суму  грн.
3G3M1-A2007 3G3M1-series.pdf
3G3M1-A2007
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.75/1.1kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.75/1.1kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+48546.92 грн
В кошику  од. на суму  грн.
3G3M1-A2004 3G3M1-series.pdf
3G3M1-A2004
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.4/0.75kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.4/0.75kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+39755.18 грн
В кошику  од. на суму  грн.
3G3M1-A2022 3G3M1-series.pdf
3G3M1-A2022
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+61942.38 грн
В кошику  од. на суму  грн.
3G3MX2-A4015-EV2 mx2-ev2-EN.pdf
3G3MX2-A4015-EV2
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x380÷480VAC
Manufacturer series: 3G3MX2
IP rating: IP20
Operating temperature: -10...50°C
The programming method: keypad; operator panel; PC
Electrical connection: screw terminals
Type of automation module: vector inverter
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
Number of analog inputs: 3
Voltage between phases (for three phase system): 3 x 380...480V AC
Number of inputs: 10
Max motor power: 1.5/2.2kW
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+72393.28 грн
В кошику  од. на суму  грн.
K8DS-PZ2 K8DS-PZ.pdf
K8DS-PZ2
Виробник: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PZ; SPDT
Manufacturer series: K8DS-PZ
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: overvoltage; phase asymmetry; phase failure; phase sequence; undervoltage
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+11167.44 грн
В кошику  од. на суму  грн.
K8DS-PA2 K8DS-PA.pdf
K8DS-PA2
Виробник: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PA; SPDT
Manufacturer series: K8DS-PA
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: phase asymmetry; phase failure; phase sequence
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+8247.50 грн
В кошику  од. на суму  грн.
S8VK-T48024 S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf
S8VK-T48024
Виробник: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 480W; 24VDC; 20A; OUT: 1
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 150x125x95mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 20A
Output voltage: 24V DC
Efficiency: 91%
Supply voltage: 450...600V DC
Power: 480W
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+28340.69 грн
В кошику  од. на суму  грн.
S8VK-T12024 S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf
S8VK-T12024
Виробник: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 120W; 24VDC; 5A; 450÷600VDC
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 122.2x104.6x40mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 5A
Output voltage: 24V DC
Efficiency: 89%
Supply voltage: 450...600V DC
Power: 0.12kW
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 9 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+15353.64 грн
5+13693.17 грн
В кошику  од. на суму  грн.
XS2F-M12PVC4A5M XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf
XS2F-M12PVC4A5M
Виробник: OMRON
Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M12 female; angled; Len: 5m
Connector: plug
Number of pins: 4
Max. operating voltage: 125V DC
Type of connection cable: for sensors/automation
IP rating: IP67
Wire insulation material: PVC
Operating temperature: -10...80°C
Cable external diameter: 5mm
Max. operating current: 4A
Cable length: 5m
Polarisation: A code - DeviceNet / CANopen
Connector variant: angled
Cable/adapter structure: M12 female
Manufacturer series: XS2
Insulation colour: black
на замовлення 44 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+1500.54 грн
5+1274.00 грн
10+1253.68 грн
В кошику  од. на суму  грн.
E2V-X4B1-M1 e2v_en.pdf
E2V-X4B1-M1
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 100mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 40Hz
Overall length: 60mm
Number of pins: 3
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+11823.81 грн
5+10262.26 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-C1 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS15-WP-C1 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2696.60 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-B1 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS10-WP-B1 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2762.23 грн
В кошику  од. на суму  грн.
E2E-X15B1T30 5M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X15B1T30 5M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷15mm; 10÷30VDC; M30; 5m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 5m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+4913.67 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-C1 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS10-WP-C1 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2826.05 грн
В кошику  од. на суму  грн.
E2E-X15B230 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X15B230 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
Kind of forehead: embedded
IP rating: IP67
Switch housing: M30
Plating material: nickel
Output configuration: PNP / NC
Operating temperature: -25...70°C
Range: 0...15mm
Overall length: 60mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 250Hz
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+4619.22 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-B2 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS15-WP-B2 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Body material: brass
Connection: cables
Kind of forehead: embedded
IP rating: IP67
Switch housing: M30
Plating material: nickel
Output configuration: PNP / NC
Operating temperature: -25...70°C
Range: 0...15mm
Overall length: 60mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 250Hz
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+3029.34 грн
В кошику  од. на суму  грн.
E2E-X22B1T30 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X22B1T30 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+6331.26 грн
В кошику  од. на суму  грн.
E2E-X22C130 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X22C130 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Plating material: nickel
Manufacturer series: E2E Next
Trade name: E2E Next
Lead length: 2m
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+6234.62 грн
В кошику  од. на суму  грн.
E2E-X22B230 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X22B230 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NC
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+5971.16 грн
В кошику  од. на суму  грн.
NX701-1700
NX701-1700
Виробник: OMRON
Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
NX701-Z700
NX701-Z700
Виробник: OMRON
Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
E2A-M12KS04-M1-B1 E2A-replacement.pdf e2a.pdf
E2A-M12KS04-M1-B1
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 200mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -40...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 1kHz
Overall length: 48mm
Plating material: nickel
Number of pins: 4
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1A-E-CV-HA-DC12
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 12VDC; Icontacts max: 16A; G2RL
Type of relay: electromagnetic
Coil voltage: 12V DC
Contact current max.: 16A
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 360Ω
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 33.3mA
Operate time: 15ms
Switched voltage: max. 440V AC
Release time: 5ms
Current rating: 16A
Relay variant: monostable; power
Operating temperature: -40...85°C
Leads: for PCB
на замовлення 28 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
20+361.92 грн
Мінімальне замовлення: 20 шт
В кошику  од. на суму  грн.
E3AS-HL500MT M3 E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf
E3AS-HL500MT M3
Виробник: OMRON
Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+30007.14 грн
В кошику  од. на суму  грн.
E3AS-HL500LMT M3 E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf
E3AS-HL500LMT M3
Виробник: OMRON
Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+30501.25 грн
В кошику  од. на суму  грн.
M2DT-500GY PushbuttonSwitches_brochure_en_200704.pdf
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; green; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: green
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500R PushbuttonSwitches_brochure_en_200704.pdf
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; red; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: red
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500W
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; white; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: white
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500Y PushbuttonSwitches_brochure_en_200704.pdf
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; yellow; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: yellow
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
S8FS-G15048CD S8FS-G-DTE.pdf
S8FS-G15048CD
Виробник: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 150W; 48VDC; 3.3A; OUT: 1
Mounting: for DIN rail mounting
Kind of power supply: for DIN rail
Type of power supply: switching
Electrical connection: terminal block
Operating temperature: -20...70°C
Body dimensions: 197x97x39.2mm
Number of outputs: 1
Output current: 3.3A
Output voltage: 48V DC
Supply voltage: 80...370V DC; 100...240V AC
Efficiency: 88%
Power: 150W
Protection: anti-overload OPP; short circuit protection SCP
товару немає в наявності
В кошику  од. на суму  грн.
D4N-1132 d4n.PDF
D4N-1132
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: PG13,5
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
Switching frequency max: 2Hz
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2161.47 грн
В кошику  од. на суму  грн.
D4N-4132 d4n.PDF
D4N-4132
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M20
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
Switching frequency max: 2Hz
на замовлення 11 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2129.56 грн
В кошику  од. на суму  грн.
D4MC-5040 d4mc.PDF
D4MC-5040
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; pusher with parallel roller; SPDT; 10A; max.250VAC
Type of sensor: limit switch
Kind of actuator: pusher with parallel roller
Output configuration: SPDT
Contact current max.: 10A
Switched voltage: max. 250V AC
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -10...80°C
Mounting holes pitch: 25.4mm
на замовлення 5 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+3954.64 грн
5+3445.30 грн
В кошику  од. на суму  грн.
AX-GPM01-ICE
Виробник: OMRON
Category: Three Phase Inverters
Description: Grounding plates
Type of control accessories: grounding plates
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1-E-DC24
G2RL-1-E-DC24
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VDC; SPDT; G2RL; power,monostable
Type of relay: electromagnetic
Coil voltage: 24V DC
Contacts configuration: SPDT
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 1.44kΩ
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 16.7mA
Height: 15.7mm
Operate time: 15ms
Release time: 5ms
IP rating: IP67
Current rating: 16A
Relay variant: monostable; power
Coil power consumption: 400mW
Operating temperature: -40...85°C
на замовлення 3574 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
31+236.11 грн
100+204.01 грн
Мінімальне замовлення: 31 шт
В кошику  од. на суму  грн.
Обрати Сторінку:   [  << Попередня Сторінка ]  1 44 88 132 176 220 264 308 352 396 405 406 407 408 409 410 411 412 413 414 415 440 447  [ Наступна Сторінка >> ]