Продукція > OMRON > Всі товари виробника OMRON (28749) > Сторінка 460 з 480

Обрати Сторінку:   [  << Попередня Сторінка ]  1 48 96 144 192 240 288 336 384 432 455 456 457 458 459 460 461 462 463 464 465 480  [ Наступна Сторінка >> ]
Фото Назва Виробник Інформація Доступність
Ціна
3G3MX2-A2110-EV2 OMRON mx2-ev2-EN.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 11/15kW; 3x200÷240VAC; IN: 10
Type of automation module: vector inverter
Max motor power: 11/15kW
Voltage between phases (for three phase system): 3 x 200...240V AC
Electrical connection: screw terminals
Mounting: for wall mounting
The programming method: keypad; operator panel; PC
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Number of inputs: 10
Number of analog inputs: 3
Operating temperature: -10...50°C
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
IP rating: IP20
Manufacturer series: 3G3MX2
товару немає в наявності
В кошику  од. на суму  грн.
D2S-10 D2S-10 OMRON en-d2s.pdf Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION; SPDT; ON-(ON); D2S; IP67; -25÷85°C; 1.5N
Contacts configuration: SPDT
Manufacturer series: D2S
Mounting: screw type
Leads: for soldering
Operating temperature: -25...85°C
IP rating: IP67
Type of switch: microswitch SNAP ACTION
Switching method: ON-(ON)
Button shape: round
Operating Force: 1.5N
на замовлення 596 шт:
термін постачання 21-30 дні (днів)
596+187.23 грн
Мінімальне замовлення: 596
В кошику  од. на суму  грн.
A8GS-C1210 OMRON en-a8gs.pdf Category: Rocker Switches
Description: ROCKER; DPST; ON-OFF; black; none; Rcont max: 100mΩ; 15.2x27.7mm
Contacts configuration: DPST
Mounting: on panel; SNAP-IN
Leads: for soldering
Operating temperature: -10...55°C
Key button colour: black
Min. insulation resistance: 0.1GΩ
Type of switch: ROCKER
Illumination: none
Switching method: ON-OFF
Shape: rectangular
Contact material: silver
Contact plating: silver plated
Mounting hole diameter: 15.2x27.7mm
Max. contact resistance:: 100mΩ
Electrical life: 10000 cycles
на замовлення 50 шт:
термін постачання 21-30 дні (днів)
50+939.66 грн
Мінімальне замовлення: 50
В кошику  од. на суму  грн.
B5T-007001-010 OMRON en-b5t.pdf Category: Unclassified
Description: B5T-007001-010
на замовлення 2 шт:
термін постачання 21-30 дні (днів)
1+41806.06 грн
В кошику  од. на суму  грн.
CPM2C-BAT01 CPM2C-BAT01 OMRON pVersion=0046&contRep=ZT&docId=005056AB90B41EDC83F6F97C33B100C7&compId=CPM2C_en.pdf?ci_sign=a8177cd5bd08514788e3f4efac78059237347b69 Category: PLC Drivers
Description: Battery
Type of control accessories: battery
Related items: CPM2C
товару немає в наявності
В кошику  од. на суму  грн.
F3S-TGR-NMPC-20-10 F3S-TGR-NMPC-20-10 OMRON pVersion=0046&contRep=ZT&docId=005056AB90B41EDBB3CDCB84A9BC40C7&compId=f3s-tgr-n_c_en.pdf?ci_sign=4b6e17906b9889e50c2cda88ba0eb2ce5df5cd25 Category: Standard Safety Switches
Description: Safety switch: magnetic; F3S-TGR-N_C; NC x2; IP67; plastic; 200mA
Type of safety switch: magnetic
Manufacturer series: F3S-TGR-N_C
Contacts configuration: NC x2
IP rating: IP67
Body material: plastic
Max. operating current: 200mA
Operating temperature: -25...80°C
Body dimensions: 13x26x41mm
Switched voltage: max. 24V DC
Range: 20mm
Kit contents: magnet; sensor
Connection: cables
Lead length: 10m
на замовлення 8 шт:
термін постачання 21-30 дні (днів)
1+10916.49 грн
5+9461.01 грн
В кошику  од. на суму  грн.
D3VM0820F D3VM0820F OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 100 шт:
термін постачання 21-30 дні (днів)
100+220.78 грн
Мінімальне замовлення: 100
В кошику  од. на суму  грн.
G2R-1A4-AC120 G2R-1A4-AC120 OMRON en-g2r.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 120VAC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Rated coil voltage: 120V AC
Contact current max.: 10A
Manufacturer series: G2R
Mounting: THT
Coil resistance: 6.5kΩ
Operate time: 15ms
Coil current: 7.5mA
Leads: for soldering
Operating temperature: -40...70°C
Coil power consumption: 0.9W
Number of pins: 4
Current rating: 8A
Contact material: Ag
на замовлення 272 шт:
термін постачання 21-30 дні (днів)
7+987.35 грн
35+824.98 грн
Мінімальне замовлення: 7
В кошику  од. на суму  грн.
H3DS-GL H3DS-GL OMRON pVersion=0046&contRep=ZT&docId=005056AB90B41EDBB3E90621839820C7&compId=H3DS_EN.pdf?ci_sign=f10d3671842c3e32ea6667021ad4dad45ab1095b Category: Analogue Timers
Description: Timer; 1s÷120s; SPST-NO x2; 250VAC/5A; Usup: 24÷230VAC; 24÷48VDC
Type of module: timer
Supply voltage: 24...48V DC; 24...230V AC
Operating temperature: -10...55°C
Electrical connection: screw terminals
Body dimensions: 17.5x73x80mm
Output 1 electrical parameters: 250V AC / 5A
Counting range: 1s...120s
Counter operation modes: star delta
Kind of output: SPST-NO x2
Mounting: for DIN rail mounting
IP rating: IP20 at terminal side; IP30 (from the front)
на замовлення 2 шт:
термін постачання 21-30 дні (днів)
1+9133.43 грн
В кошику  од. на суму  грн.
H3DK-G 24-240AC/DC H3DK-G 24-240AC/DC OMRON pVersion=0046&contRep=ZT&docId=005056AB752F1EE2B188F677BEC20135&compId=h3dk.PDF?ci_sign=240be4e6285560fdfa392804f9cf72842a018de1 Category: Analogue Timers
Description: Timer; 1s÷120s; DPDT; 250VAC/5A; Usup: 24÷240VAC; 24÷240VDC; H3DK-G
Type of module: timer
Supply voltage: 24...240V AC; 24...240V DC
Operating temperature: -20...55°C
Indication: LED
Electrical connection: screw terminals
Number of operation modes: 1
Number of pins: 8
Output 1 electrical parameters: 250V AC / 5A
Counting range: 1s...120s
Counter operation modes: star delta
Manufacturer series: H3DK-G
Kind of output: DPDT
Mounting: for DIN rail mounting
IP rating: IP20
на замовлення 2 шт:
термін постачання 21-30 дні (днів)
1+8294.45 грн
В кошику  од. на суму  грн.
D41L-1ZDA-N2 OMRON Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to release; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to release
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-1ZDG-N2 OMRON Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to lock; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to lock
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-2ZDA-N2 OMRON Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to release; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to release
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-2ZDG-N2 OMRON Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to lock; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to lock
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-2ZDGE-N2 OMRON Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Electr.connect: M12 8pin; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to lock; with emergency release
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
H3Y-2 AC200-230 120S H3Y-2 AC200-230 120S OMRON Category: Analogue Timers
Description: Automation module: timer; 5÷120s; DPDT; 250VAC/5A; H3Y; socket
Type of automation module: timer
Counting range: 5...120s
Kind of output: DPDT
Supply voltage: 200...230V AC
Manufacturer series: H3Y
Number of operation modes: 1
Counter operation modes: delayed switching on
Mounting: socket
Operating temperature: -10...50°C
Number of pins: 8
IP rating: IP40
Related items: PYF08A-E; PYF08A-N
Output 1 electrical parameters: 250V AC / 5A
товару немає в наявності
В кошику  од. на суму  грн.
F3SG-4RA1225-25-01TS OMRON Category: Light Curtains
Description: Safety light curtain; H: 1225mm; 300mm÷17m; IP67; F3SG-R Robust
Sensors features: hand protection
IP rating: IP67
Kind of output 1: NPN; PNP
Kit contents: receiver; transmitter
Type of sensor: safety light curtain
Operation mode: transmitter-receiver
Operating temperature: -10...55°C
Switched current, max.: 300mA
Height: 1225mm
Supply voltage: 24V DC
Range: 300mm...17m
Safety category: 4
Resolution: 25mm
Enclosure material: aluminium
Manufacturer series: F3SG-R Robust
товару немає в наявності
В кошику  од. на суму  грн.
K8AK-PW2 K8AK-PW2 OMRON pVersion=0046&contRep=ZT&docId=005056AB752F1EE585846153A9E5C469&compId=K8AK-PW.pdf?ci_sign=f93bceab8cef8dce0634d2023f42d523c400bff9 Category: Monitoring Relays
Description: Undervoltage,overvoltage; for DIN rail mounting; K8AK-PW; SPDT
Controlled parameter: overvoltage; undervoltage
Mounting: for DIN rail mounting
Manufacturer series: K8AK-PW
Kind of output 1: SPDT
Operating temperature: -20...60°C
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Leads: screw terminals
Contact actuation delay: 0.1...30s
IP rating: IP20
Body dimensions: 22.5x90x100mm
Power supply: from tested wiring system
Type of automation module: voltage monitoring relay
Kind of output 2: SPDT
Controlled parameter range: 3x 220V AC...480V AC
Voltage between phases (for three phase system): 3 x 220...480V AC
Output 2 electrical parameters: 24V DC / 5A; 250V AC / 5A
на замовлення 4 шт:
термін постачання 21-30 дні (днів)
1+10138.44 грн
В кошику  од. на суму  грн.
K8AK-PM2 K8AK-PM2 OMRON K8AK-PM.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8AK-PM; SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
IP rating: IP20
Controlled parameter: overvoltage; phase failure; phase sequence; undervoltage
Leads: screw terminals
Kind of output 2: SPDT
Type of automation module: voltage monitoring relay
Operating temperature: -20...60°C
Contact actuation delay: 0.1...30s
Body dimensions: 22.5x90x100mm
Voltage between phases (for three phase system): 3 x 220...480V AC
Controlled parameter range: 3x 220V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Output 2 electrical parameters: 24V DC / 5A; 250V AC / 5A
Manufacturer series: K8AK-PM
Kind of output 1: SPDT
на замовлення 5 шт:
термін постачання 21-30 дні (днів)
1+10831.71 грн
5+9401.15 грн
В кошику  од. на суму  грн.
GX-ID1611 GX-ID1611 OMRON gx_ds_e_9_14_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: NPN
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 2-tier terminal block
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
GX-ID1612 GX-ID1612 OMRON gx_ds_e_8_2_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Operating temperature: -10...55°C
Type of automation module: digital input
Manufacturer series: GX
IP rating: IP20
Kind of input 1: NPN
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 3-tier terminal block
товару немає в наявності
В кошику  од. на суму  грн.
GX-ID1618 GX-ID1618 OMRON gx_ds_e_8_2_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: NPN
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: e-CON connector type
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
GX-ID1621 GX-ID1621 OMRON gx_ds_e_9_14_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: PNP
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 2-tier terminal block
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
R88D-KN30F-ECT-L R88D-KN30F-ECT-L OMRON Category: Electric Motors
Description: Automation module: servo driver; 3kW; 400VAC; Accurax G5
Supply voltage: 400V AC
Power: 3kW
Manufacturer series: Accurax G5
Communictions protocol: EtherCAT
Type of automation module: servo driver
товару немає в наявності
В кошику  од. на суму  грн.
R88D-KN30H-ECT R88D-KN30H-ECT OMRON i100e_r88m-k_accurax_g5_servo_motors_datasheet_en.pdf Category: Electric Motors
Description: Automation module: servo driver; 3kW; 230VAC; Accurax G5
Supply voltage: 230V AC
Power: 3kW
Manufacturer series: Accurax G5
Communictions protocol: EtherCAT
Type of automation module: servo driver
товару немає в наявності
В кошику  од. на суму  грн.
R88D-KN30H-ECT-L OMRON Category: Electric Motors
Description: Automation module: servo driver; 3kW; 230VAC; Accurax G5
Supply voltage: 230V AC
Power: 3kW
Manufacturer series: Accurax G5
Communictions protocol: EtherCAT
Type of automation module: servo driver
товару немає в наявності
В кошику  од. на суму  грн.
G5LE-1-DC12 G5LE-1-DC12 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 12VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPDT
Rated coil voltage: 12V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: PCB
Coil resistance: 360Ω
Operate time: 10ms
Body dimensions: 22.5x16.5x19mm
Coil power consumption: 400mW
Coil current: 33.3mA
Operating temperature: -25...85°C
Leads: for PCB
Number of pins: 5
Current rating: 10A
Electrical life: 100000 cycles
на замовлення 3799 шт:
термін постачання 21-30 дні (днів)
61+113.04 грн
350+82.01 грн
500+77.09 грн
Мінімальне замовлення: 61
В кошику  од. на суму  грн.
G5LE-1 DC9 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 9VDC; Icontacts max: 10A; G5LE
Type of relay: electromagnetic
Contacts configuration: SPDT
Rated coil voltage: 9V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: THT
Coil resistance: 200Ω
Operate time: 10ms
Coil power consumption: 400mW
Coil current: 45mA
Operating temperature: -25...85°C
Leads: for soldering
Current rating: 10A
Electrical life: 100000 cycles
Contact material: AgSnO
на замовлення 800 шт:
термін постачання 21-30 дні (днів)
40+171.33 грн
365+136.95 грн
730+131.21 грн
Мінімальне замовлення: 40
В кошику  од. на суму  грн.
H3Y-2 DC24 30S H3Y-2 DC24 30S OMRON H3Y-series.pdf Category: Analogue Timers
Description: Automation module: timer; 1÷30s; DPDT; 250VAC/5A; 24VDC; H3Y; PIN: 8
Number of pins: 8
Related items: PYF08A-E; PYF08A-N
Mounting: socket
Manufacturer series: H3Y
IP rating: IP40
Type of automation module: timer
Operating temperature: -10...50°C
Number of operation modes: 1
Supply voltage: 24V DC
Output 1 electrical parameters: 250V AC / 5A
Counting range: 1...30s
Counter operation modes: delayed switching on
Kind of output: DPDT
на замовлення 8 шт:
термін постачання 21-30 дні (днів)
1+5531.10 грн
5+4800.62 грн
В кошику  од. на суму  грн.
GX-OD1612 GX-OD1612 OMRON gx_ds_e_9_14_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital output; -10÷55°C; IP20; GX; 24VDC
Operating temperature: -10...55°C
Type of automation module: digital output
Manufacturer series: GX
IP rating: IP20
Kind of output 1: NPN
Supply voltage: 24V DC
Number of outputs: 16
Modules features: 3-tier terminal block
товару немає в наявності
В кошику  од. на суму  грн.
GX-MD1612 GX-MD1612 OMRON gx_ds_e_8_2_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital input/output; -10÷55°C; IP20; GX; IN: 8
Operating temperature: -10...55°C
Type of automation module: digital input/output
Manufacturer series: GX
IP rating: IP20
Supply voltage: 24V DC
Number of inputs: 8
Number of outputs: 8
Modules features: 3-tier terminal block
товару немає в наявності
В кошику  од. на суму  грн.
G3PJ-225B-PU DC12-24 G3PJ-225B-PU DC12-24 OMRON G3PJ-EN.pdf G3PJ-brochure.pdf Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 12÷24VDC; 25A; 24÷240VAC; G3PJ; 1-phase
Type of relay: solid state
Control voltage: 12...24V DC
Max. operating current: 25A
Switched voltage: 24...240V AC
Manufacturer series: G3PJ
Relay variant: 1-phase
Mounting: for DIN rail mounting; on panel
Body dimensions: 100x22.5x100mm
Switching method: zero voltage switching
Design: heatsink
Operating temperature: -30...80°C
на замовлення 1 шт:
термін постачання 21-30 дні (днів)
1+7941.19 грн
В кошику  од. на суму  грн.
G3PJ-525B-PU DC12-24 G3PJ-525B-PU DC12-24 OMRON G3PJ-brochure.pdf G3PJ-EN.pdf Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 12÷24VDC; 25A; 100÷480VAC; G3PJ
Type of relay: solid state
Control voltage: 12...24V DC
Max. operating current: 25A
Switched voltage: 100...480V AC
Manufacturer series: G3PJ
Relay variant: 1-phase
Mounting: for DIN rail mounting; on panel
Body dimensions: 100x22.5x100mm
Switching method: zero voltage switching
Design: heatsink
Operating temperature: -30...80°C
на замовлення 1 шт:
термін постачання 21-30 дні (днів)
1+11743.11 грн
В кошику  од. на суму  грн.
H3Y-2 AC24 10M H3Y-2 AC24 10M OMRON Category: Analogue Timers
Description: Automation module: timer; 0,5min÷10min; DPDT; 250VAC/5A; H3Y; IP40
Type of automation module: timer
Counting range: 0,5min...10min
Kind of output: DPDT
Supply voltage: 24V AC
Manufacturer series: H3Y
Number of operation modes: 1
Counter operation modes: delayed switching on
Mounting: socket
Operating temperature: -10...50°C
Number of pins: 8
IP rating: IP40
Related items: PYF08A-E; PYF08A-N
Output 1 electrical parameters: 250V AC / 5A
товару немає в наявності
В кошику  од. на суму  грн.
H3Y-2 AC200-230 10M H3Y-2 AC200-230 10M OMRON Category: Analogue Timers
Description: Automation module: timer; 0,5min÷10min; DPDT; 250VAC/5A; H3Y; IP40
Type of automation module: timer
Counting range: 0,5min...10min
Kind of output: DPDT
Supply voltage: 200...230V AC
Manufacturer series: H3Y
Number of operation modes: 1
Counter operation modes: delayed switching on
Mounting: socket
Operating temperature: -10...50°C
Number of pins: 8
IP rating: IP40
Related items: PYF08A-E; PYF08A-N
Output 1 electrical parameters: 250V AC / 5A
товару немає в наявності
В кошику  од. на суму  грн.
44506-2726 44506-2726 OMRON ER6022_EN.pdf Category: Line Operated Safety Switches
Description: Mounting kit; ER1022, ER5018, ER6022
Type of safety switch accessories: mounting kit
Manufacturer series: ER1022, ER5018, ER6022
товару немає в наявності
В кошику  од. на суму  грн.
D4N-2232 D4N-2232 OMRON d4n_ds_e_10_8_csm1248.pdf?id=1497 Category: Limit Switches
Description: Limit switch; plastic roller; 10A; max.240VAC; max.250VDC; G 1/2"
Type of sensor: limit switch
IP rating: IP67
Connection: G 1/2"
Body material: plastic
Operating temperature: -30...70°C
Kind of actuator: plastic roller
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
на замовлення 6 шт:
термін постачання 21-30 дні (днів)
1+1840.46 грн
5+1597.47 грн
В кошику  од. на суму  грн.
GX-ID1622 GX-ID1622 OMRON gx_ds_e_9_14_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: PNP
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 3-tier terminal block
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
GX-OC1601 GX-OC1601 OMRON gx_ds_e_9_14_csm1003469.pdf Category: I/O Systems and Modules
Description: Automation module: digital output; -10÷55°C; IP20; GX; 24VDC
Manufacturer series: GX
IP rating: IP20
Kind of output 1: SPST-NO
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of outputs: 16
Modules features: 2-tier terminal block
Type of automation module: digital output
товару немає в наявності
В кошику  од. на суму  грн.
G2R-24-AC24 OMRON en-g2r.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic
Type of relay: electromagnetic
на замовлення 92 шт:
термін постачання 21-30 дні (днів)
15+468.06 грн
90+328.84 грн
Мінімальне замовлення: 15
В кошику  од. на суму  грн.
TL-W5MB1 5M TL-W5MB1 5M OMRON TL-W%20Prox%20Sensor.pdf Category: Rectangle Inductive Sensors
Description: Sensor: inductive; 0÷5mm; PNP / NO; cables; 5m; TL
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...5mm
Lead length: 5m
Connection: cables
Manufacturer series: TL
товару немає в наявності
В кошику  од. на суму  грн.
D4N-4C32R D4N-4C32R OMRON d4n-_r_ds_e_5_2_csm1252.pdf Category: Limit Switches
Description: Limit switch; 10A; max.240VAC; max.250VDC; M20; IP67; -30÷70°C
Type of sensor: limit switch
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M20
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
на замовлення 4 шт:
термін постачання 21-30 дні (днів)
1+5176.08 грн
В кошику  од. на суму  грн.
D4N-9B31 D4N-9B31 OMRON c130d4nminiaturesafetylimitswitchdatasheeten.pdf Category: Limit Switches
Description: Limit switch; 10A; max.240VAC; max.250VDC; M12; IP67; -30÷70°C
Type of sensor: limit switch
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M12
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
на замовлення 3 шт:
термін постачання 21-30 дні (днів)
1+6368.32 грн
В кошику  од. на суму  грн.
G6K-2F-Y-DC24 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; DPDT; Ucoil: 24VDC; Icontacts max: 1A; G6K
Type of relay: electromagnetic
Contacts configuration: DPDT
Rated coil voltage: 24V DC
Contact current max.: 1A
Manufacturer series: G6K
Relay variant: monostable; sensitive
Mounting: SMD
Operate time: 3ms
Leads: for soldering
Operating temperature: -40...85°C
Coil resistance: 5.22kΩ
Electrical life: 100000 cycles
Number of pins: 8
Coil current: 4.6mA
Current rating: 1A
Coil power consumption: 100mW
на замовлення 2853 шт:
термін постачання 21-30 дні (днів)
27+258.76 грн
200+187.79 грн
350+183.69 грн
500+177.13 грн
Мінімальне замовлення: 27
В кошику  од. на суму  грн.
G6K-2P-DC24 G6K-2P-DC24 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic
Type of relay: electromagnetic
на замовлення 603 шт:
термін постачання 21-30 дні (днів)
23+307.33 грн
150+223.88 грн
300+219.78 грн
500+211.58 грн
Мінімальне замовлення: 23
В кошику  од. на суму  грн.
P2DN-15.7-100S P2DN-15.7-100S OMRON G2R-_-S-General-Purpose-Relay-Datasheet.pdf Category: Electromagnetic Relays - Accessories
Description: Connection bridge; blue; G2R-1-S,G2R-2-S
Related items: P2RFZ-05-E; P2RFZ-08-E
Colour: blue
Type of relays accessories: connection bridge
Application - series/manufacturer: G2R-1-S; G2R-2-S
на замовлення 40 шт:
термін постачання 21-30 дні (днів)
1+2658.25 грн
10+2244.50 грн
30+2182.17 грн
В кошику  од. на суму  грн.
PYDN-15.5-080Y PYDN-15.5-080Y OMRON Category: Electromagnetic Relays - Accessories
Description: Connection bridge
Related items: P2RFZ-05-E; P2RFZ-08-E
Type of relays accessories: connection bridge
на замовлення 11 шт:
термін постачання 21-30 дні (днів)
1+461.00 грн
10+391.17 грн
В кошику  од. на суму  грн.
G5RL6303E OMRON eng5rl.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 5VDC; G5RL; THT; 62.5Ω
Type of relay: electromagnetic
Manufacturer series: G5RL
Contacts configuration: SPST-NO
Mounting: THT
Operating temperature: -40...85°C
Rated coil voltage: 5V DC
Coil resistance: 62.5Ω
Contact material: Ag
на замовлення 100 шт:
термін постачання 21-30 дні (днів)
29+234.03 грн
100+179.59 грн
Мінімальне замовлення: 29
В кошику  од. на суму  грн.
A22NL-MNA-TWA-G002-WC A22NL-MNA-TWA-G002-WC OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MNA-TWA-G002-WD A22NL-MNA-TWA-G002-WD OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MNA-TWA-G002-WE A22NL-MNA-TWA-G002-WE OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 200...240V AC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MNM-TWA-G002-WD A22NL-MNM-TWA-G002-WD OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MPA-TWA-G002-WC A22NL-MPA-TWA-G002-WC OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MPM-TWA-G002-WD A22NL-MPM-TWA-G002-WD OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NN-MPA-NWA-G002-NN A22NN-MPA-NWA-G002-NN OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; white; none; IP66; A22NN
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: white
Illumination: none
IP rating: IP66
Manufacturer series: A22NN
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Operating temperature: -25...70°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NN-MPM-NWA-G002-NN A22NN-MPM-NWA-G002-NN OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 1; NC; white; none; IP66; A22NN
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: white
Illumination: none
IP rating: IP66
Manufacturer series: A22NN
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Operating temperature: -25...70°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2ML-TWA-G002-WC A22NW-2ML-TWA-G002-WC OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Switches features: Automatic reset on left.
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2ML-TWA-G002-WD A22NW-2ML-TWA-G002-WD OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Switches features: Automatic reset on left.
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2ML-TWA-G002-YC A22NW-2ML-TWA-G002-YC OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: yellow
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Switches features: Automatic reset on left.
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2MM-TWA-G002-YD A22NW-2MM-TWA-G002-YD OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: yellow
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
товару немає в наявності
В кошику  од. на суму  грн.
3G3MX2-A2110-EV2 mx2-ev2-EN.pdf
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 11/15kW; 3x200÷240VAC; IN: 10
Type of automation module: vector inverter
Max motor power: 11/15kW
Voltage between phases (for three phase system): 3 x 200...240V AC
Electrical connection: screw terminals
Mounting: for wall mounting
The programming method: keypad; operator panel; PC
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Number of inputs: 10
Number of analog inputs: 3
Operating temperature: -10...50°C
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
IP rating: IP20
Manufacturer series: 3G3MX2
товару немає в наявності
В кошику  од. на суму  грн.
D2S-10 en-d2s.pdf
D2S-10
Виробник: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION; SPDT; ON-(ON); D2S; IP67; -25÷85°C; 1.5N
Contacts configuration: SPDT
Manufacturer series: D2S
Mounting: screw type
Leads: for soldering
Operating temperature: -25...85°C
IP rating: IP67
Type of switch: microswitch SNAP ACTION
Switching method: ON-(ON)
Button shape: round
Operating Force: 1.5N
на замовлення 596 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
596+187.23 грн
Мінімальне замовлення: 596
В кошику  од. на суму  грн.
A8GS-C1210 en-a8gs.pdf
Виробник: OMRON
Category: Rocker Switches
Description: ROCKER; DPST; ON-OFF; black; none; Rcont max: 100mΩ; 15.2x27.7mm
Contacts configuration: DPST
Mounting: on panel; SNAP-IN
Leads: for soldering
Operating temperature: -10...55°C
Key button colour: black
Min. insulation resistance: 0.1GΩ
Type of switch: ROCKER
Illumination: none
Switching method: ON-OFF
Shape: rectangular
Contact material: silver
Contact plating: silver plated
Mounting hole diameter: 15.2x27.7mm
Max. contact resistance:: 100mΩ
Electrical life: 10000 cycles
на замовлення 50 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
50+939.66 грн
Мінімальне замовлення: 50
В кошику  од. на суму  грн.
B5T-007001-010 en-b5t.pdf
Виробник: OMRON
Category: Unclassified
Description: B5T-007001-010
на замовлення 2 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+41806.06 грн
В кошику  од. на суму  грн.
CPM2C-BAT01 pVersion=0046&contRep=ZT&docId=005056AB90B41EDC83F6F97C33B100C7&compId=CPM2C_en.pdf?ci_sign=a8177cd5bd08514788e3f4efac78059237347b69
CPM2C-BAT01
Виробник: OMRON
Category: PLC Drivers
Description: Battery
Type of control accessories: battery
Related items: CPM2C
товару немає в наявності
В кошику  од. на суму  грн.
F3S-TGR-NMPC-20-10 pVersion=0046&contRep=ZT&docId=005056AB90B41EDBB3CDCB84A9BC40C7&compId=f3s-tgr-n_c_en.pdf?ci_sign=4b6e17906b9889e50c2cda88ba0eb2ce5df5cd25
F3S-TGR-NMPC-20-10
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: magnetic; F3S-TGR-N_C; NC x2; IP67; plastic; 200mA
Type of safety switch: magnetic
Manufacturer series: F3S-TGR-N_C
Contacts configuration: NC x2
IP rating: IP67
Body material: plastic
Max. operating current: 200mA
Operating temperature: -25...80°C
Body dimensions: 13x26x41mm
Switched voltage: max. 24V DC
Range: 20mm
Kit contents: magnet; sensor
Connection: cables
Lead length: 10m
на замовлення 8 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+10916.49 грн
5+9461.01 грн
В кошику  од. на суму  грн.
D3VM0820F
D3VM0820F
Виробник: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
на замовлення 100 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
100+220.78 грн
Мінімальне замовлення: 100
В кошику  од. на суму  грн.
G2R-1A4-AC120 en-g2r.pdf
G2R-1A4-AC120
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 120VAC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Rated coil voltage: 120V AC
Contact current max.: 10A
Manufacturer series: G2R
Mounting: THT
Coil resistance: 6.5kΩ
Operate time: 15ms
Coil current: 7.5mA
Leads: for soldering
Operating temperature: -40...70°C
Coil power consumption: 0.9W
Number of pins: 4
Current rating: 8A
Contact material: Ag
на замовлення 272 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
7+987.35 грн
35+824.98 грн
Мінімальне замовлення: 7
В кошику  од. на суму  грн.
H3DS-GL pVersion=0046&contRep=ZT&docId=005056AB90B41EDBB3E90621839820C7&compId=H3DS_EN.pdf?ci_sign=f10d3671842c3e32ea6667021ad4dad45ab1095b
H3DS-GL
Виробник: OMRON
Category: Analogue Timers
Description: Timer; 1s÷120s; SPST-NO x2; 250VAC/5A; Usup: 24÷230VAC; 24÷48VDC
Type of module: timer
Supply voltage: 24...48V DC; 24...230V AC
Operating temperature: -10...55°C
Electrical connection: screw terminals
Body dimensions: 17.5x73x80mm
Output 1 electrical parameters: 250V AC / 5A
Counting range: 1s...120s
Counter operation modes: star delta
Kind of output: SPST-NO x2
Mounting: for DIN rail mounting
IP rating: IP20 at terminal side; IP30 (from the front)
на замовлення 2 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+9133.43 грн
В кошику  од. на суму  грн.
H3DK-G 24-240AC/DC pVersion=0046&contRep=ZT&docId=005056AB752F1EE2B188F677BEC20135&compId=h3dk.PDF?ci_sign=240be4e6285560fdfa392804f9cf72842a018de1
H3DK-G 24-240AC/DC
Виробник: OMRON
Category: Analogue Timers
Description: Timer; 1s÷120s; DPDT; 250VAC/5A; Usup: 24÷240VAC; 24÷240VDC; H3DK-G
Type of module: timer
Supply voltage: 24...240V AC; 24...240V DC
Operating temperature: -20...55°C
Indication: LED
Electrical connection: screw terminals
Number of operation modes: 1
Number of pins: 8
Output 1 electrical parameters: 250V AC / 5A
Counting range: 1s...120s
Counter operation modes: star delta
Manufacturer series: H3DK-G
Kind of output: DPDT
Mounting: for DIN rail mounting
IP rating: IP20
на замовлення 2 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+8294.45 грн
В кошику  од. на суму  грн.
D41L-1ZDA-N2
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to release; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to release
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-1ZDG-N2
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to lock; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to lock
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-2ZDA-N2
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to release; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to release
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-2ZDG-N2
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Features: power to lock; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to lock
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
D41L-2ZDGE-N2
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D41L; Electr.connect: M12 8pin; 24VDC
Type of safety switch: bolting
Related items: D41L8P5CFM12905M; D41L8P5CFM12910M; D41L-A1; D41L-MP
Manufacturer series: D41L
Electrical connection: M12 8pin
Output configuration: PNP
Safety switches features: power to lock; with emergency release
Supply voltage: 24V DC
Sensors features: actuator is sold separately
товару немає в наявності
В кошику  од. на суму  грн.
H3Y-2 AC200-230 120S
H3Y-2 AC200-230 120S
Виробник: OMRON
Category: Analogue Timers
Description: Automation module: timer; 5÷120s; DPDT; 250VAC/5A; H3Y; socket
Type of automation module: timer
Counting range: 5...120s
Kind of output: DPDT
Supply voltage: 200...230V AC
Manufacturer series: H3Y
Number of operation modes: 1
Counter operation modes: delayed switching on
Mounting: socket
Operating temperature: -10...50°C
Number of pins: 8
IP rating: IP40
Related items: PYF08A-E; PYF08A-N
Output 1 electrical parameters: 250V AC / 5A
товару немає в наявності
В кошику  од. на суму  грн.
F3SG-4RA1225-25-01TS
Виробник: OMRON
Category: Light Curtains
Description: Safety light curtain; H: 1225mm; 300mm÷17m; IP67; F3SG-R Robust
Sensors features: hand protection
IP rating: IP67
Kind of output 1: NPN; PNP
Kit contents: receiver; transmitter
Type of sensor: safety light curtain
Operation mode: transmitter-receiver
Operating temperature: -10...55°C
Switched current, max.: 300mA
Height: 1225mm
Supply voltage: 24V DC
Range: 300mm...17m
Safety category: 4
Resolution: 25mm
Enclosure material: aluminium
Manufacturer series: F3SG-R Robust
товару немає в наявності
В кошику  од. на суму  грн.
K8AK-PW2 pVersion=0046&contRep=ZT&docId=005056AB752F1EE585846153A9E5C469&compId=K8AK-PW.pdf?ci_sign=f93bceab8cef8dce0634d2023f42d523c400bff9
K8AK-PW2
Виробник: OMRON
Category: Monitoring Relays
Description: Undervoltage,overvoltage; for DIN rail mounting; K8AK-PW; SPDT
Controlled parameter: overvoltage; undervoltage
Mounting: for DIN rail mounting
Manufacturer series: K8AK-PW
Kind of output 1: SPDT
Operating temperature: -20...60°C
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Leads: screw terminals
Contact actuation delay: 0.1...30s
IP rating: IP20
Body dimensions: 22.5x90x100mm
Power supply: from tested wiring system
Type of automation module: voltage monitoring relay
Kind of output 2: SPDT
Controlled parameter range: 3x 220V AC...480V AC
Voltage between phases (for three phase system): 3 x 220...480V AC
Output 2 electrical parameters: 24V DC / 5A; 250V AC / 5A
на замовлення 4 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+10138.44 грн
В кошику  од. на суму  грн.
K8AK-PM2 K8AK-PM.pdf
K8AK-PM2
Виробник: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8AK-PM; SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
IP rating: IP20
Controlled parameter: overvoltage; phase failure; phase sequence; undervoltage
Leads: screw terminals
Kind of output 2: SPDT
Type of automation module: voltage monitoring relay
Operating temperature: -20...60°C
Contact actuation delay: 0.1...30s
Body dimensions: 22.5x90x100mm
Voltage between phases (for three phase system): 3 x 220...480V AC
Controlled parameter range: 3x 220V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Output 2 electrical parameters: 24V DC / 5A; 250V AC / 5A
Manufacturer series: K8AK-PM
Kind of output 1: SPDT
на замовлення 5 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+10831.71 грн
5+9401.15 грн
В кошику  од. на суму  грн.
GX-ID1611 gx_ds_e_9_14_csm1003469.pdf
GX-ID1611
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: NPN
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 2-tier terminal block
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
GX-ID1612 gx_ds_e_8_2_csm1003469.pdf
GX-ID1612
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Operating temperature: -10...55°C
Type of automation module: digital input
Manufacturer series: GX
IP rating: IP20
Kind of input 1: NPN
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 3-tier terminal block
товару немає в наявності
В кошику  од. на суму  грн.
GX-ID1618 gx_ds_e_8_2_csm1003469.pdf
GX-ID1618
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: NPN
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: e-CON connector type
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
GX-ID1621 gx_ds_e_9_14_csm1003469.pdf
GX-ID1621
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: PNP
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 2-tier terminal block
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
R88D-KN30F-ECT-L
R88D-KN30F-ECT-L
Виробник: OMRON
Category: Electric Motors
Description: Automation module: servo driver; 3kW; 400VAC; Accurax G5
Supply voltage: 400V AC
Power: 3kW
Manufacturer series: Accurax G5
Communictions protocol: EtherCAT
Type of automation module: servo driver
товару немає в наявності
В кошику  од. на суму  грн.
R88D-KN30H-ECT i100e_r88m-k_accurax_g5_servo_motors_datasheet_en.pdf
R88D-KN30H-ECT
Виробник: OMRON
Category: Electric Motors
Description: Automation module: servo driver; 3kW; 230VAC; Accurax G5
Supply voltage: 230V AC
Power: 3kW
Manufacturer series: Accurax G5
Communictions protocol: EtherCAT
Type of automation module: servo driver
товару немає в наявності
В кошику  од. на суму  грн.
R88D-KN30H-ECT-L
Виробник: OMRON
Category: Electric Motors
Description: Automation module: servo driver; 3kW; 230VAC; Accurax G5
Supply voltage: 230V AC
Power: 3kW
Manufacturer series: Accurax G5
Communictions protocol: EtherCAT
Type of automation module: servo driver
товару немає в наявності
В кошику  од. на суму  грн.
G5LE-1-DC12 en-g5le.pdf
G5LE-1-DC12
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 12VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPDT
Rated coil voltage: 12V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: PCB
Coil resistance: 360Ω
Operate time: 10ms
Body dimensions: 22.5x16.5x19mm
Coil power consumption: 400mW
Coil current: 33.3mA
Operating temperature: -25...85°C
Leads: for PCB
Number of pins: 5
Current rating: 10A
Electrical life: 100000 cycles
на замовлення 3799 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
61+113.04 грн
350+82.01 грн
500+77.09 грн
Мінімальне замовлення: 61
В кошику  од. на суму  грн.
G5LE-1 DC9 en-g5le.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 9VDC; Icontacts max: 10A; G5LE
Type of relay: electromagnetic
Contacts configuration: SPDT
Rated coil voltage: 9V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: THT
Coil resistance: 200Ω
Operate time: 10ms
Coil power consumption: 400mW
Coil current: 45mA
Operating temperature: -25...85°C
Leads: for soldering
Current rating: 10A
Electrical life: 100000 cycles
Contact material: AgSnO
на замовлення 800 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
40+171.33 грн
365+136.95 грн
730+131.21 грн
Мінімальне замовлення: 40
В кошику  од. на суму  грн.
H3Y-2 DC24 30S H3Y-series.pdf
H3Y-2 DC24 30S
Виробник: OMRON
Category: Analogue Timers
Description: Automation module: timer; 1÷30s; DPDT; 250VAC/5A; 24VDC; H3Y; PIN: 8
Number of pins: 8
Related items: PYF08A-E; PYF08A-N
Mounting: socket
Manufacturer series: H3Y
IP rating: IP40
Type of automation module: timer
Operating temperature: -10...50°C
Number of operation modes: 1
Supply voltage: 24V DC
Output 1 electrical parameters: 250V AC / 5A
Counting range: 1...30s
Counter operation modes: delayed switching on
Kind of output: DPDT
на замовлення 8 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+5531.10 грн
5+4800.62 грн
В кошику  од. на суму  грн.
GX-OD1612 gx_ds_e_9_14_csm1003469.pdf
GX-OD1612
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital output; -10÷55°C; IP20; GX; 24VDC
Operating temperature: -10...55°C
Type of automation module: digital output
Manufacturer series: GX
IP rating: IP20
Kind of output 1: NPN
Supply voltage: 24V DC
Number of outputs: 16
Modules features: 3-tier terminal block
товару немає в наявності
В кошику  од. на суму  грн.
GX-MD1612 gx_ds_e_8_2_csm1003469.pdf
GX-MD1612
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital input/output; -10÷55°C; IP20; GX; IN: 8
Operating temperature: -10...55°C
Type of automation module: digital input/output
Manufacturer series: GX
IP rating: IP20
Supply voltage: 24V DC
Number of inputs: 8
Number of outputs: 8
Modules features: 3-tier terminal block
товару немає в наявності
В кошику  од. на суму  грн.
G3PJ-225B-PU DC12-24 G3PJ-EN.pdf G3PJ-brochure.pdf
G3PJ-225B-PU DC12-24
Виробник: OMRON
Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 12÷24VDC; 25A; 24÷240VAC; G3PJ; 1-phase
Type of relay: solid state
Control voltage: 12...24V DC
Max. operating current: 25A
Switched voltage: 24...240V AC
Manufacturer series: G3PJ
Relay variant: 1-phase
Mounting: for DIN rail mounting; on panel
Body dimensions: 100x22.5x100mm
Switching method: zero voltage switching
Design: heatsink
Operating temperature: -30...80°C
на замовлення 1 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+7941.19 грн
В кошику  од. на суму  грн.
G3PJ-525B-PU DC12-24 G3PJ-brochure.pdf G3PJ-EN.pdf
G3PJ-525B-PU DC12-24
Виробник: OMRON
Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 12÷24VDC; 25A; 100÷480VAC; G3PJ
Type of relay: solid state
Control voltage: 12...24V DC
Max. operating current: 25A
Switched voltage: 100...480V AC
Manufacturer series: G3PJ
Relay variant: 1-phase
Mounting: for DIN rail mounting; on panel
Body dimensions: 100x22.5x100mm
Switching method: zero voltage switching
Design: heatsink
Operating temperature: -30...80°C
на замовлення 1 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+11743.11 грн
В кошику  од. на суму  грн.
H3Y-2 AC24 10M
H3Y-2 AC24 10M
Виробник: OMRON
Category: Analogue Timers
Description: Automation module: timer; 0,5min÷10min; DPDT; 250VAC/5A; H3Y; IP40
Type of automation module: timer
Counting range: 0,5min...10min
Kind of output: DPDT
Supply voltage: 24V AC
Manufacturer series: H3Y
Number of operation modes: 1
Counter operation modes: delayed switching on
Mounting: socket
Operating temperature: -10...50°C
Number of pins: 8
IP rating: IP40
Related items: PYF08A-E; PYF08A-N
Output 1 electrical parameters: 250V AC / 5A
товару немає в наявності
В кошику  од. на суму  грн.
H3Y-2 AC200-230 10M
H3Y-2 AC200-230 10M
Виробник: OMRON
Category: Analogue Timers
Description: Automation module: timer; 0,5min÷10min; DPDT; 250VAC/5A; H3Y; IP40
Type of automation module: timer
Counting range: 0,5min...10min
Kind of output: DPDT
Supply voltage: 200...230V AC
Manufacturer series: H3Y
Number of operation modes: 1
Counter operation modes: delayed switching on
Mounting: socket
Operating temperature: -10...50°C
Number of pins: 8
IP rating: IP40
Related items: PYF08A-E; PYF08A-N
Output 1 electrical parameters: 250V AC / 5A
товару немає в наявності
В кошику  од. на суму  грн.
44506-2726 ER6022_EN.pdf
44506-2726
Виробник: OMRON
Category: Line Operated Safety Switches
Description: Mounting kit; ER1022, ER5018, ER6022
Type of safety switch accessories: mounting kit
Manufacturer series: ER1022, ER5018, ER6022
товару немає в наявності
В кошику  од. на суму  грн.
D4N-2232 d4n_ds_e_10_8_csm1248.pdf?id=1497
D4N-2232
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; plastic roller; 10A; max.240VAC; max.250VDC; G 1/2"
Type of sensor: limit switch
IP rating: IP67
Connection: G 1/2"
Body material: plastic
Operating temperature: -30...70°C
Kind of actuator: plastic roller
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
на замовлення 6 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+1840.46 грн
5+1597.47 грн
В кошику  од. на суму  грн.
GX-ID1622 gx_ds_e_9_14_csm1003469.pdf
GX-ID1622
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital input; -10÷55°C; IP20; GX; 24VDC; IN: 16
Manufacturer series: GX
IP rating: IP20
Kind of input 1: PNP
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of inputs: 16
Modules features: 3-tier terminal block
Type of automation module: digital input
товару немає в наявності
В кошику  од. на суму  грн.
GX-OC1601 gx_ds_e_9_14_csm1003469.pdf
GX-OC1601
Виробник: OMRON
Category: I/O Systems and Modules
Description: Automation module: digital output; -10÷55°C; IP20; GX; 24VDC
Manufacturer series: GX
IP rating: IP20
Kind of output 1: SPST-NO
Operating temperature: -10...55°C
Supply voltage: 24V DC
Number of outputs: 16
Modules features: 2-tier terminal block
Type of automation module: digital output
товару немає в наявності
В кошику  од. на суму  грн.
G2R-24-AC24 en-g2r.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic
Type of relay: electromagnetic
на замовлення 92 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
15+468.06 грн
90+328.84 грн
Мінімальне замовлення: 15
В кошику  од. на суму  грн.
TL-W5MB1 5M TL-W%20Prox%20Sensor.pdf
TL-W5MB1 5M
Виробник: OMRON
Category: Rectangle Inductive Sensors
Description: Sensor: inductive; 0÷5mm; PNP / NO; cables; 5m; TL
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...5mm
Lead length: 5m
Connection: cables
Manufacturer series: TL
товару немає в наявності
В кошику  од. на суму  грн.
D4N-4C32R d4n-_r_ds_e_5_2_csm1252.pdf
D4N-4C32R
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; 10A; max.240VAC; max.250VDC; M20; IP67; -30÷70°C
Type of sensor: limit switch
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M20
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
на замовлення 4 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+5176.08 грн
В кошику  од. на суму  грн.
D4N-9B31 c130d4nminiaturesafetylimitswitchdatasheeten.pdf
D4N-9B31
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; 10A; max.240VAC; max.250VDC; M12; IP67; -30÷70°C
Type of sensor: limit switch
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M12
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
на замовлення 3 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+6368.32 грн
В кошику  од. на суму  грн.
G6K-2F-Y-DC24
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; DPDT; Ucoil: 24VDC; Icontacts max: 1A; G6K
Type of relay: electromagnetic
Contacts configuration: DPDT
Rated coil voltage: 24V DC
Contact current max.: 1A
Manufacturer series: G6K
Relay variant: monostable; sensitive
Mounting: SMD
Operate time: 3ms
Leads: for soldering
Operating temperature: -40...85°C
Coil resistance: 5.22kΩ
Electrical life: 100000 cycles
Number of pins: 8
Coil current: 4.6mA
Current rating: 1A
Coil power consumption: 100mW
на замовлення 2853 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
27+258.76 грн
200+187.79 грн
350+183.69 грн
500+177.13 грн
Мінімальне замовлення: 27
В кошику  од. на суму  грн.
G6K-2P-DC24
G6K-2P-DC24
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic
Type of relay: electromagnetic
на замовлення 603 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
23+307.33 грн
150+223.88 грн
300+219.78 грн
500+211.58 грн
Мінімальне замовлення: 23
В кошику  од. на суму  грн.
P2DN-15.7-100S G2R-_-S-General-Purpose-Relay-Datasheet.pdf
P2DN-15.7-100S
Виробник: OMRON
Category: Electromagnetic Relays - Accessories
Description: Connection bridge; blue; G2R-1-S,G2R-2-S
Related items: P2RFZ-05-E; P2RFZ-08-E
Colour: blue
Type of relays accessories: connection bridge
Application - series/manufacturer: G2R-1-S; G2R-2-S
на замовлення 40 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+2658.25 грн
10+2244.50 грн
30+2182.17 грн
В кошику  од. на суму  грн.
PYDN-15.5-080Y
PYDN-15.5-080Y
Виробник: OMRON
Category: Electromagnetic Relays - Accessories
Description: Connection bridge
Related items: P2RFZ-05-E; P2RFZ-08-E
Type of relays accessories: connection bridge
на замовлення 11 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
1+461.00 грн
10+391.17 грн
В кошику  од. на суму  грн.
G5RL6303E eng5rl.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 5VDC; G5RL; THT; 62.5Ω
Type of relay: electromagnetic
Manufacturer series: G5RL
Contacts configuration: SPST-NO
Mounting: THT
Operating temperature: -40...85°C
Rated coil voltage: 5V DC
Coil resistance: 62.5Ω
Contact material: Ag
на замовлення 100 шт:
термін постачання 21-30 дні (днів)
Кількість Ціна
29+234.03 грн
100+179.59 грн
Мінімальне замовлення: 29
В кошику  од. на суму  грн.
A22NL-MNA-TWA-G002-WC
A22NL-MNA-TWA-G002-WC
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MNA-TWA-G002-WD
A22NL-MNA-TWA-G002-WD
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MNA-TWA-G002-WE
A22NL-MNA-TWA-G002-WE
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 200...240V AC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MNM-TWA-G002-WD
A22NL-MNM-TWA-G002-WD
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Button shape: flat
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MPA-TWA-G002-WC
A22NL-MPA-TWA-G002-WC
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NL-MPM-TWA-G002-WD
A22NL-MPM-TWA-G002-WD
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NL
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NN-MPA-NWA-G002-NN
A22NN-MPA-NWA-G002-NN
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 2; NC; white; none; IP66; A22NN
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: white
Illumination: none
IP rating: IP66
Manufacturer series: A22NN
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Operating temperature: -25...70°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NN-MPM-NWA-G002-NN
A22NN-MPM-NWA-G002-NN
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: push-button; 22mm; Stabl.pos: 1; NC; white; none; IP66; A22NN
Type of switch: push-button
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: white
Illumination: none
IP rating: IP66
Manufacturer series: A22NN
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Operating temperature: -25...70°C
Button shape: prominent
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2ML-TWA-G002-WC
A22NW-2ML-TWA-G002-WC
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Switches features: Automatic reset on left.
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2ML-TWA-G002-WD
A22NW-2ML-TWA-G002-WD
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: white
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
Switches features: Automatic reset on left.
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2ML-TWA-G002-YC
A22NW-2ML-TWA-G002-YC
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 1; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 1
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: yellow
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 24V AC; 24V DC
Operating temperature: -25...55°C
Switches features: Automatic reset on left.
товару немає в наявності
В кошику  од. на суму  грн.
A22NW-2MM-TWA-G002-YD
A22NW-2MM-TWA-G002-YD
Виробник: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 2; NC; transparent; LED; IP66; A22NW
Type of switch: rotary
Switch standard: 22mm
Stable positions number: 2
Contacts configuration: NC
Actuator colour: transparent
Illumination: LED
Backlight colour: yellow
IP rating: IP66
Manufacturer series: A22NW
Number of positions: 2
Mounting hole diameter: Ø22.3mm
Leads: screw terminals
Supply voltage: 100...120V AC
Operating temperature: -25...55°C
товару немає в наявності
В кошику  од. на суму  грн.
Обрати Сторінку:   [  << Попередня Сторінка ]  1 48 96 144 192 240 288 336 384 432 455 456 457 458 459 460 461 462 463 464 465 480  [ Наступна Сторінка >> ]