Продукція > OMRON > Всі товари виробника OMRON (27209) > Сторінка 412 з 454

Обрати Сторінку:   [  << Попередня Сторінка ]  1 45 90 135 180 225 270 315 360 405 407 408 409 410 411 412 413 414 415 416 417 450 454  [ Наступна Сторінка >> ]
Фото Назва Виробник Інформація Доступність Ціна без ПДВ
E6C3-CWZ3XH 3600P/R 1M E6C3-CWZ3XH 3600P/R 1M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
D4N-4ARE OMRON c130d4nminiaturesafetylimitswitchdatasheeten.pdf Category: Limit Switches
Description: Limit switch; roller lever; 10A; max.240VAC; max.250VDC; M20; IP67
Operating temperature: -30...70°C
Type of sensor: limit switch
Connection: M20
Body material: plastic
Kind of actuator: roller lever
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
IP rating: IP67
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 1M E6C3-CWZ3XH 200P/R 1M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 2M E6C3-CWZ3XH 200P/R 2M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 1M E6C3-CWZ3XH 2048P/R 1M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 2M E6C3-CWZ3XH 2048P/R 2M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
3G3M1-A4015 3G3M1-A4015 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x400VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 1.5/2.2kW
Inverter output voltage: 3 x 400V AC
Voltage between phases (for three phase system): 3 x 380...480V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+52916.36 грн
В кошику  од. на суму  грн.
3G3M1-A4022 3G3M1-A4022 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x400VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 2.2/3kW
Inverter output voltage: 3 x 400V AC
Voltage between phases (for three phase system): 3 x 380...480V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+59141.86 грн
В кошику  од. на суму  грн.
3G3M1-A4040 3G3M1-A4040 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 4/5.5kW; 3x400VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 4/5.5kW
Inverter output voltage: 3 x 400V AC
Voltage between phases (for three phase system): 3 x 380...480V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+72049.60 грн
В кошику  од. на суму  грн.
3G3M1-A2007 3G3M1-A2007 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.75/1.1kW; 3x230VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 0.75/1.1kW
Inverter output voltage: 3 x 230V AC
Voltage between phases (for three phase system): 3 x 200...240V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+47604.30 грн
В кошику  од. на суму  грн.
3G3M1-A2004 3G3M1-A2004 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.4/0.75kW; 3x230VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 0.4/0.75kW
Inverter output voltage: 3 x 230V AC
Voltage between phases (for three phase system): 3 x 200...240V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+38983.03 грн
В кошику  од. на суму  грн.
3G3M1-A2022 3G3M1-A2022 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x230VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 2.2/3kW
Inverter output voltage: 3 x 230V AC
Voltage between phases (for three phase system): 3 x 200...240V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+60739.03 грн
В кошику  од. на суму  грн.
3G3MX2-A4015-EV2 3G3MX2-A4015-EV2 OMRON mx2-ev2-EN.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x380÷480VAC
Manufacturer series: 3G3MX2
IP rating: IP20
Operating temperature: -10...50°C
The programming method: keypad; operator panel; PC
Electrical connection: screw terminals
Type of automation module: vector inverter
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
Number of analog inputs: 3
Voltage between phases (for three phase system): 3 x 380...480V AC
Number of inputs: 10
Max motor power: 1.5/2.2kW
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+72393.28 грн
В кошику  од. на суму  грн.
K8DS-PZ2 K8DS-PZ2 OMRON K8DS-PZ.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PZ; SPDT
Manufacturer series: K8DS-PZ
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: overvoltage; phase asymmetry; phase failure; phase sequence; undervoltage
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+11167.44 грн
В кошику  од. на суму  грн.
K8DS-PA2 K8DS-PA2 OMRON K8DS-PA.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PA; SPDT
Manufacturer series: K8DS-PA
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: phase asymmetry; phase failure; phase sequence
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+8247.50 грн
В кошику  од. на суму  грн.
S8VK-T48024 S8VK-T48024 OMRON S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 480W; 24VDC; 20A; OUT: 1
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 150x125x95mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 20A
Output voltage: 24V DC
Efficiency: 91%
Supply voltage: 450...600V DC
Power: 480W
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+28340.69 грн
В кошику  од. на суму  грн.
S8VK-T12024 S8VK-T12024 OMRON S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 120W; 24VDC; 5A; 450÷600VDC
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 122.2x104.6x40mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 5A
Output voltage: 24V DC
Efficiency: 89%
Supply voltage: 450...600V DC
Power: 0.12kW
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 9 шт:
термін постачання 14-30 дні (днів)
1+15353.64 грн
5+13693.17 грн
В кошику  од. на суму  грн.
XS2F-M12PVC4A5M XS2F-M12PVC4A5M OMRON XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M12 female; angled; Len: 5m
Connector: plug
Number of pins: 4
Max. operating voltage: 125V DC
Type of connection cable: for sensors
IP rating: IP67
Wire insulation material: PVC
Operating temperature: -10...80°C
Cable external diameter: 5mm
Max. operating current: 4A
Cable length: 5m
Polarisation: A code - DeviceNet / CANopen
Connector variant: angled
Cable/adapter structure: M12 female
Manufacturer series: XS2
Insulation colour: black
на замовлення 44 шт:
термін постачання 14-30 дні (днів)
1+1500.54 грн
5+1274.00 грн
10+1253.68 грн
В кошику  од. на суму  грн.
E2V-X4B1-M1 E2V-X4B1-M1 OMRON e2v_en.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 100mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 40Hz
Overall length: 60mm
Number of pins: 3
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
1+11823.81 грн
5+10262.26 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-C1 2M E2B-M30KS15-WP-C1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
1+2696.60 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-B1 2M E2B-M30KS10-WP-B1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 400Hz
Connection: cables
Output configuration: PNP / NO
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...10mm
Type of sensor: inductive
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
1+2702.98 грн
В кошику  од. на суму  грн.
E2E-X15B1T30 5M E2E-X15B1T30 5M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷15mm; 10÷30VDC; M30; 5m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 5m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+4913.67 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-C1 2M E2B-M30KS10-WP-C1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
1+2826.05 грн
В кошику  од. на суму  грн.
E2E-X15B230 2M E2E-X15B230 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Manufacturer series: E2E Next
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
Trade name: E2E Next
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+4576.37 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-B2 2M E2B-M30KS15-WP-B2 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
1+3001.08 грн
В кошику  од. на суму  грн.
E2E-X22B1T30 2M E2E-X22B1T30 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+6331.26 грн
В кошику  од. на суму  грн.
E2E-X22C130 2M E2E-X22C130 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Plating material: nickel
Manufacturer series: E2E Next
Trade name: E2E Next
Lead length: 2m
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+6234.62 грн
В кошику  од. на суму  грн.
E2E-X22B230 2M E2E-X22B230 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NC
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
1+5971.16 грн
В кошику  од. на суму  грн.
NX701-1700 NX701-1700 OMRON Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
NX701-Z700 NX701-Z700 OMRON Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
E2A-M12KS04-M1-B1 E2A-M12KS04-M1-B1 OMRON E2A-replacement.pdf e2a.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 200mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -40...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 1kHz
Overall length: 48mm
Plating material: nickel
Number of pins: 4
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1A-E-CV-HA-DC12 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 12VDC; Icontacts max: 16A; G2RL
Type of relay: electromagnetic
Coil voltage: 12V DC
Contact current max.: 16A
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 360Ω
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 33.3mA
Operate time: 15ms
Switched voltage: max. 440V AC
Release time: 5ms
Current rating: 16A
Relay variant: monostable; power
Operating temperature: -40...85°C
Leads: for PCB
на замовлення 28 шт:
термін постачання 14-30 дні (днів)
20+361.92 грн
Мінімальне замовлення: 20 шт
В кошику  од. на суму  грн.
E3AS-HL500MT M3 E3AS-HL500MT M3 OMRON E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+30007.14 грн
В кошику  од. на суму  грн.
E3AS-HL500LMT M3 E3AS-HL500LMT M3 OMRON E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
1+30501.25 грн
В кошику  од. на суму  грн.
M2DT-500GY OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; green; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: green
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500R OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; red; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: red
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500W OMRON Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; white; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: white
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500Y OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; yellow; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: yellow
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
S8FS-G15048CD S8FS-G15048CD OMRON S8FS-G-DTE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 150W; 48VDC; 3.3A; OUT: 1
Mounting: for DIN rail mounting
Kind of power supply: for DIN rail
Type of power supply: switching
Electrical connection: terminal block
Operating temperature: -20...70°C
Body dimensions: 197x97x39.2mm
Number of outputs: 1
Output current: 3.3A
Output voltage: 48V DC
Supply voltage: 80...370V DC; 100...240V AC
Efficiency: 88%
Power: 150W
Protection: anti-overload OPP; short circuit protection SCP
товару немає в наявності
В кошику  од. на суму  грн.
D4N-1132 D4N-1132 OMRON d4n.PDF Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: PG13,5
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
Switching frequency max: 2Hz
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
1+2161.47 грн
В кошику  од. на суму  грн.
D4N-4132 D4N-4132 OMRON d4n.PDF Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M20
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Switching frequency max: 2Hz
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
на замовлення 7 шт:
термін постачання 14-30 дні (днів)
1+2080.33 грн
В кошику  од. на суму  грн.
D4MC-5040 D4MC-5040 OMRON d4mc.PDF Category: Limit Switches
Description: Limit switch; pusher with parallel roller; SPDT; 10A; max.250VAC
Type of sensor: limit switch
Kind of actuator: pusher with parallel roller
Output configuration: SPDT
Contact current max.: 10A
Switched voltage: max. 250V AC
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -10...80°C
Mounting holes pitch: 25.4mm
на замовлення 5 шт:
термін постачання 14-30 дні (днів)
1+3954.64 грн
5+3445.30 грн
В кошику  од. на суму  грн.
AX-GPM01-ICE OMRON Category: Three Phase Inverters
Description: Grounding plates
Type of control accessories: grounding plates
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1-E-DC24 G2RL-1-E-DC24 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VDC; SPDT; G2RL; power,monostable
Type of relay: electromagnetic
Coil voltage: 24V DC
Contacts configuration: SPDT
Manufacturer series: G2RL
Relay variant: monostable; power
Mounting: THT
Coil resistance: 1.44kΩ
Operate time: 15ms
Body dimensions: 29x12.7x15.7mm
Release time: 5ms
Coil power consumption: 400mW
IP rating: IP67
Contact material: silver alloy
Coil current: 16.7mA
Height: 15.7mm
Current rating: 16A
Operating temperature: -40...85°C
на замовлення 3360 шт:
термін постачання 14-30 дні (днів)
31+234.29 грн
100+202.32 грн
Мінімальне замовлення: 31 шт
В кошику  од. на суму  грн.
G5LE-1A4-DC9 G5LE-1A4-DC9 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 9VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Coil voltage: 9V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable
Mounting: THT
Coil resistance: 200Ω
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 45mA
Operating temperature: -25...85°C
Leads: for PCB
Electrical life: 100000 cycles
Height: 19mm
Contact material: AgSnO
Number of pins: 4
Current rating: 10A
на замовлення 277 шт:
термін постачання 14-30 дні (днів)
48+151.33 грн
240+126.98 грн
Мінімальне замовлення: 48 шт
В кошику  од. на суму  грн.
G5LE-1A-DC5 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 5VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Coil voltage: 5V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: PCB
Coil resistance: 63Ω
Operate time: 10ms
Body dimensions: 22.5x16.5x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 79.4mA
Operating temperature: -25...85°C
Leads: for PCB
Height: 19mm
Number of pins: 4
Current rating: 10A
Electrical life: 100000 cycles
Contact material: AgSnO
на замовлення 250 шт:
термін постачання 14-30 дні (днів)
63+109.40 грн
Мінімальне замовлення: 63 шт
В кошику  од. на суму  грн.
G5LE-14-DC24 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VDC; SPDT; Icontacts max: 10A
Type of relay: electromagnetic
Coil voltage: 24V DC
Contacts configuration: SPDT
Contact current max.: 10A
Manufacturer series: G5LE
Switched voltage: max. 250V AC
Relay variant: monostable; power
Mounting: THT
Coil resistance: 1.44kΩ
Operate time: 10ms
Release time: 5ms
Coil power consumption: 400mW
Coil current: 16.7mA
Operating temperature: -25...85°C
Height: 19mm
Contact material: AgSnO
Current rating: 10A
Leads: for PCB
Electrical life: 100000 cycles
на замовлення 2313 шт:
термін постачання 14-30 дні (днів)
48+150.42 грн
250+110.89 грн
500+102.43 грн
Мінімальне замовлення: 48 шт
В кошику  од. на суму  грн.
G5LE-14-DC36 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 36VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPDT
Coil voltage: 36V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: THT
Coil resistance: 3.24kΩ
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil current: 11.1mA
Leads: for PCB
Height: 19mm
Contact material: AgSnO
Current rating: 10A
на замовлення 175 шт:
термін постачання 14-30 дні (днів)
47+155.89 грн
Мінімальне замовлення: 47 шт
В кошику  од. на суму  грн.
G5LE-14-DC6 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 6VDC; Icontacts max: 10A; G5LE
Type of relay: electromagnetic
Contacts configuration: SPDT
Coil voltage: 6V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable
Mounting: THT
Coil resistance: 90Ω
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 66.7mA
Operating temperature: -25...85°C
Leads: for PCB
Height: 19mm
Contact material: AgSnO
Number of pins: 5
Current rating: 10A
на замовлення 395 шт:
термін постачання 14-30 дні (днів)
55+132.19 грн
350+94.81 грн
Мінімальне замовлення: 55 шт
В кошику  од. на суму  грн.
G5LE-1A4-DC48 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 48VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Coil voltage: 48V DC
Contact current max.: 10A
Manufacturer series: G5LE
Mounting: THT
Coil resistance: 5.76kΩ
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 8.3mA
Operating temperature: -25...85°C
Leads: for PCB
Electrical life: 100000 cycles
Height: 19mm
Contact material: AgSnO
Number of pins: 4
Current rating: 10A
на замовлення 500 шт:
термін постачання 14-30 дні (днів)
5+1446.75 грн
25+1208.82 грн
Мінімальне замовлення: 5 шт
В кошику  од. на суму  грн.
G5LE-1 DC9 OMRON en-g5le.pdf Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 9VDC; Icontacts max: 10A; G5LE
Type of relay: electromagnetic
Contacts configuration: SPDT
Coil voltage: 9V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: THT
Coil resistance: 200Ω
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 45mA
Operating temperature: -25...85°C
Leads: for PCB
Electrical life: 100000 cycles
Height: 19mm
Contact material: AgSnO
Current rating: 10A
на замовлення 800 шт:
термін постачання 14-30 дні (днів)
40+179.59 грн
365+144.75 грн
730+138.83 грн
Мінімальне замовлення: 40 шт
В кошику  од. на суму  грн.
LY2N 24VAC LY2N 24VAC OMRON Category: Industrial Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VAC; DPDT; Icontacts max: 10A
Type of relay: electromagnetic
Coil voltage: 24V AC
Contacts configuration: DPDT
Contact current max.: 10A
AC contacts rating @R: 10A / 110V AC
DC contacts rating @R: 10A / 24V DC
Switched voltage: max. 125V DC; max. 250V AC
Relay variant: industrial
Mounting: socket
Manufacturer series: LY2
Body dimensions: 28x21.5x36mm
Coil resistance: 180Ω
Mechanical durability: 100000000 cycles
Operate time: 25ms
Release time: 25ms
Switching capacity: 240W; 1100VA
Contact resistance: 50mΩ
Coil power consumption: 0.9W
Leads: connectors
Leads dimensions: 4.8x0.5mm
Operating temperature: -25...40°C
Indication: LED
Coil voltage min.: 19.2V AC
Related items: PT08-0; PTF08A-E; PTFZ-08-E
на замовлення 30 шт:
термін постачання 14-30 дні (днів)
1+953.56 грн
5+805.03 грн
10+764.40 грн
В кошику  од. на суму  грн.
LY2N 220/240VAC LY2N 220/240VAC OMRON ly.pdf Category: Industrial Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 230VAC; DPDT; Icontacts max: 10A
Type of relay: electromagnetic
Coil voltage: 230V AC
Contacts configuration: DPDT
Contact current max.: 10A
AC contacts rating @R: 10A / 110V AC
DC contacts rating @R: 10A / 24V DC
Switched voltage: max. 125V DC; max. 250V AC
Relay variant: industrial
Mounting: socket
Manufacturer series: LY2
Body dimensions: 28x21.5x36mm
Coil resistance: 18.79kΩ
Mechanical durability: 50000000 cycles
Operate time: 25ms
Release time: 25ms
Switching capacity: 240W; 1100VA
Contact resistance: 50mΩ
Coil power consumption: 1.2VA
Leads: connectors
Leads dimensions: 4.8x0.5mm
Operating temperature: -25...40°C
Indication: LED
Coil voltage min.: 192V AC
Related items: PT08-0; PTF08A-E; PTFZ-08-E
на замовлення 187 шт:
термін постачання 14-30 дні (днів)
1+1321.86 грн
5+883.76 грн
25+852.44 грн
В кошику  од. на суму  грн.
D4NL-4AFA-BS D4NL-4AFA-BS OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC + NO; IP67; Electr.connect: M20
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC + NO
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4EFA-B D4NL-4EFA-B OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x2 + NO; IP67; plastic; black/red
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x2 + NO
Safety switches features: LED status indicator; no key; power to release
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4EFG-B D4NL-4EFG-B OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x2 + NO; IP67; plastic; black/red
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x2 + NO
Safety switches features: LED status indicator; no key; power to lock
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4DFA-B D4NL-4DFA-B OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x2; Number of key entry slots: 4
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x2
Safety switches features: LED status indicator; no key; power to release
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC x2
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4ADA-B D4NL-4ADA-B OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC + NO; IP67; Electr.connect: M20
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC + NO
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4HFG-B D4NL-4HFG-B OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x3; Number of key entry slots: 4
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x3
Safety switches features: LED status indicator; no key; power to lock
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC x2
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4HFA-B4 D4NL-4HFA-B4 OMRON D4NL_EN.pdf D4NL_DE.pdf Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x3; Number of key entry slots: 4
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x3
Safety switches features: LED status indicator; power to release
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC x2
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 3600P/R 1M e6c3-c_ds_e_7_3_csm495.pdf
E6C3-CWZ3XH 3600P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
товару немає в наявності
В кошику  од. на суму  грн.
D4N-4ARE c130d4nminiaturesafetylimitswitchdatasheeten.pdf
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; roller lever; 10A; max.240VAC; max.250VDC; M20; IP67
Operating temperature: -30...70°C
Type of sensor: limit switch
Connection: M20
Body material: plastic
Kind of actuator: roller lever
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
IP rating: IP67
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 1M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 200P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 200P/R 2M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 200P/R 2M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 1M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 2048P/R 1M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
E6C3-CWZ3XH 2048P/R 2M e6c3-c_ds_e_7_2_csm495.pdf
E6C3-CWZ3XH 2048P/R 2M
Виробник: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
товару немає в наявності
В кошику  од. на суму  грн.
3G3M1-A4015 3G3M1-series.pdf
3G3M1-A4015
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x400VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 1.5/2.2kW
Inverter output voltage: 3 x 400V AC
Voltage between phases (for three phase system): 3 x 380...480V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+52916.36 грн
В кошику  од. на суму  грн.
3G3M1-A4022 3G3M1-series.pdf
3G3M1-A4022
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x400VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 2.2/3kW
Inverter output voltage: 3 x 400V AC
Voltage between phases (for three phase system): 3 x 380...480V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+59141.86 грн
В кошику  од. на суму  грн.
3G3M1-A4040 3G3M1-series.pdf
3G3M1-A4040
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 4/5.5kW; 3x400VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 4/5.5kW
Inverter output voltage: 3 x 400V AC
Voltage between phases (for three phase system): 3 x 380...480V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+72049.60 грн
В кошику  од. на суму  грн.
3G3M1-A2007 3G3M1-series.pdf
3G3M1-A2007
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.75/1.1kW; 3x230VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 0.75/1.1kW
Inverter output voltage: 3 x 230V AC
Voltage between phases (for three phase system): 3 x 200...240V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+47604.30 грн
В кошику  од. на суму  грн.
3G3M1-A2004 3G3M1-series.pdf
3G3M1-A2004
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.4/0.75kW; 3x230VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 0.4/0.75kW
Inverter output voltage: 3 x 230V AC
Voltage between phases (for three phase system): 3 x 200...240V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+38983.03 грн
В кошику  од. на суму  грн.
3G3M1-A2022 3G3M1-series.pdf
3G3M1-A2022
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x230VAC; 3G3M1
Type of automation module: vector inverter
Max motor power: 2.2/3kW
Inverter output voltage: 3 x 230V AC
Voltage between phases (for three phase system): 3 x 200...240V AC
Mounting: for wall mounting
The programming method: keypad; PC
Manufacturer series: 3G3M1
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+60739.03 грн
В кошику  од. на суму  грн.
3G3MX2-A4015-EV2 mx2-ev2-EN.pdf
3G3MX2-A4015-EV2
Виробник: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x380÷480VAC
Manufacturer series: 3G3MX2
IP rating: IP20
Operating temperature: -10...50°C
The programming method: keypad; operator panel; PC
Electrical connection: screw terminals
Type of automation module: vector inverter
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
Number of analog inputs: 3
Voltage between phases (for three phase system): 3 x 380...480V AC
Number of inputs: 10
Max motor power: 1.5/2.2kW
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Mounting: for wall mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+72393.28 грн
В кошику  од. на суму  грн.
K8DS-PZ2 K8DS-PZ.pdf
K8DS-PZ2
Виробник: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PZ; SPDT
Manufacturer series: K8DS-PZ
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: overvoltage; phase asymmetry; phase failure; phase sequence; undervoltage
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+11167.44 грн
В кошику  од. на суму  грн.
K8DS-PA2 K8DS-PA.pdf
K8DS-PA2
Виробник: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PA; SPDT
Manufacturer series: K8DS-PA
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: phase asymmetry; phase failure; phase sequence
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+8247.50 грн
В кошику  од. на суму  грн.
S8VK-T48024 S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf
S8VK-T48024
Виробник: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 480W; 24VDC; 20A; OUT: 1
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 150x125x95mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 20A
Output voltage: 24V DC
Efficiency: 91%
Supply voltage: 450...600V DC
Power: 480W
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+28340.69 грн
В кошику  од. на суму  грн.
S8VK-T12024 S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf
S8VK-T12024
Виробник: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 120W; 24VDC; 5A; 450÷600VDC
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 122.2x104.6x40mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 5A
Output voltage: 24V DC
Efficiency: 89%
Supply voltage: 450...600V DC
Power: 0.12kW
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
на замовлення 9 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+15353.64 грн
5+13693.17 грн
В кошику  од. на суму  грн.
XS2F-M12PVC4A5M XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf
XS2F-M12PVC4A5M
Виробник: OMRON
Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M12 female; angled; Len: 5m
Connector: plug
Number of pins: 4
Max. operating voltage: 125V DC
Type of connection cable: for sensors
IP rating: IP67
Wire insulation material: PVC
Operating temperature: -10...80°C
Cable external diameter: 5mm
Max. operating current: 4A
Cable length: 5m
Polarisation: A code - DeviceNet / CANopen
Connector variant: angled
Cable/adapter structure: M12 female
Manufacturer series: XS2
Insulation colour: black
на замовлення 44 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+1500.54 грн
5+1274.00 грн
10+1253.68 грн
В кошику  од. на суму  грн.
E2V-X4B1-M1 e2v_en.pdf
E2V-X4B1-M1
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 100mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 40Hz
Overall length: 60mm
Number of pins: 3
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+11823.81 грн
5+10262.26 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-C1 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS15-WP-C1 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Plating material: nickel
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2696.60 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-B1 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS10-WP-B1 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 400Hz
Connection: cables
Output configuration: PNP / NO
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...10mm
Type of sensor: inductive
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2702.98 грн
В кошику  од. на суму  грн.
E2E-X15B1T30 5M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X15B1T30 5M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷15mm; 10÷30VDC; M30; 5m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 5m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+4913.67 грн
В кошику  од. на суму  грн.
E2B-M30KS10-WP-C1 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS10-WP-C1 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2826.05 грн
В кошику  од. на суму  грн.
E2E-X15B230 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X15B230 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Manufacturer series: E2E Next
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
Trade name: E2E Next
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+4576.37 грн
В кошику  од. на суму  грн.
E2B-M30KS15-WP-B2 2M e2b_d116-e1_1_5_csm1012652.pdf
E2B-M30KS15-WP-B2 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
на замовлення 4 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+3001.08 грн
В кошику  од. на суму  грн.
E2E-X22B1T30 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X22B1T30 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+6331.26 грн
В кошику  од. на суму  грн.
E2E-X22C130 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X22C130 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Plating material: nickel
Manufacturer series: E2E Next
Trade name: E2E Next
Lead length: 2m
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+6234.62 грн
В кошику  од. на суму  грн.
E2E-X22B230 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
E2E-X22B230 2M
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NC
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Trade name: E2E Next
Plating material: nickel
на замовлення 2 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+5971.16 грн
В кошику  од. на суму  грн.
NX701-1700
NX701-1700
Виробник: OMRON
Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
NX701-Z700
NX701-Z700
Виробник: OMRON
Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
товару немає в наявності
В кошику  од. на суму  грн.
E2A-M12KS04-M1-B1 E2A-replacement.pdf e2a.pdf
E2A-M12KS04-M1-B1
Виробник: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 200mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -40...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 1kHz
Overall length: 48mm
Plating material: nickel
Number of pins: 4
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1A-E-CV-HA-DC12
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 12VDC; Icontacts max: 16A; G2RL
Type of relay: electromagnetic
Coil voltage: 12V DC
Contact current max.: 16A
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 360Ω
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 33.3mA
Operate time: 15ms
Switched voltage: max. 440V AC
Release time: 5ms
Current rating: 16A
Relay variant: monostable; power
Operating temperature: -40...85°C
Leads: for PCB
на замовлення 28 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
20+361.92 грн
Мінімальне замовлення: 20 шт
В кошику  од. на суму  грн.
E3AS-HL500MT M3 E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf
E3AS-HL500MT M3
Виробник: OMRON
Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+30007.14 грн
В кошику  од. на суму  грн.
E3AS-HL500LMT M3 E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf
E3AS-HL500LMT M3
Виробник: OMRON
Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
на замовлення 1 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+30501.25 грн
В кошику  од. на суму  грн.
M2DT-500GY PushbuttonSwitches_brochure_en_200704.pdf
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; green; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: green
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500R PushbuttonSwitches_brochure_en_200704.pdf
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; red; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: red
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500W
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; white; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: white
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
M2DT-500Y PushbuttonSwitches_brochure_en_200704.pdf
Виробник: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; yellow; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: yellow
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
товару немає в наявності
В кошику  од. на суму  грн.
S8FS-G15048CD S8FS-G-DTE.pdf
S8FS-G15048CD
Виробник: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 150W; 48VDC; 3.3A; OUT: 1
Mounting: for DIN rail mounting
Kind of power supply: for DIN rail
Type of power supply: switching
Electrical connection: terminal block
Operating temperature: -20...70°C
Body dimensions: 197x97x39.2mm
Number of outputs: 1
Output current: 3.3A
Output voltage: 48V DC
Supply voltage: 80...370V DC; 100...240V AC
Efficiency: 88%
Power: 150W
Protection: anti-overload OPP; short circuit protection SCP
товару немає в наявності
В кошику  од. на суму  грн.
D4N-1132 d4n.PDF
D4N-1132
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: PG13,5
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
Switching frequency max: 2Hz
на замовлення 8 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2161.47 грн
В кошику  од. на суму  грн.
D4N-4132 d4n.PDF
D4N-4132
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; plastic roller Ø9,5mm; NO + NC; 10A; max.240VAC
Type of sensor: limit switch
Kind of actuator: plastic roller Ø9,5mm
Output configuration: NO + NC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
Connection: M20
IP rating: IP67
Body dimensions: 64x31x30mm
Number of mounting holes: 2
Operating temperature: -30...70°C
Body material: plastic
AC contacts rating @R: 3A / 240V AC
DC contacts rating @R: 0.55A / 125V DC
Switching frequency max: 2Hz
Mounting holes pitch: 20...22mm
Switches features: snap action contacts
на замовлення 7 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+2080.33 грн
В кошику  од. на суму  грн.
D4MC-5040 d4mc.PDF
D4MC-5040
Виробник: OMRON
Category: Limit Switches
Description: Limit switch; pusher with parallel roller; SPDT; 10A; max.250VAC
Type of sensor: limit switch
Kind of actuator: pusher with parallel roller
Output configuration: SPDT
Contact current max.: 10A
Switched voltage: max. 250V AC
IP rating: IP67
Number of mounting holes: 2
Operating temperature: -10...80°C
Mounting holes pitch: 25.4mm
на замовлення 5 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+3954.64 грн
5+3445.30 грн
В кошику  од. на суму  грн.
AX-GPM01-ICE
Виробник: OMRON
Category: Three Phase Inverters
Description: Grounding plates
Type of control accessories: grounding plates
товару немає в наявності
В кошику  од. на суму  грн.
G2RL-1-E-DC24
G2RL-1-E-DC24
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VDC; SPDT; G2RL; power,monostable
Type of relay: electromagnetic
Coil voltage: 24V DC
Contacts configuration: SPDT
Manufacturer series: G2RL
Relay variant: monostable; power
Mounting: THT
Coil resistance: 1.44kΩ
Operate time: 15ms
Body dimensions: 29x12.7x15.7mm
Release time: 5ms
Coil power consumption: 400mW
IP rating: IP67
Contact material: silver alloy
Coil current: 16.7mA
Height: 15.7mm
Current rating: 16A
Operating temperature: -40...85°C
на замовлення 3360 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
31+234.29 грн
100+202.32 грн
Мінімальне замовлення: 31 шт
В кошику  од. на суму  грн.
G5LE-1A4-DC9 en-g5le.pdf
G5LE-1A4-DC9
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 9VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Coil voltage: 9V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable
Mounting: THT
Coil resistance: 200Ω
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 45mA
Operating temperature: -25...85°C
Leads: for PCB
Electrical life: 100000 cycles
Height: 19mm
Contact material: AgSnO
Number of pins: 4
Current rating: 10A
на замовлення 277 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
48+151.33 грн
240+126.98 грн
Мінімальне замовлення: 48 шт
В кошику  од. на суму  грн.
G5LE-1A-DC5
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 5VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Coil voltage: 5V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: PCB
Coil resistance: 63Ω
Operate time: 10ms
Body dimensions: 22.5x16.5x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 79.4mA
Operating temperature: -25...85°C
Leads: for PCB
Height: 19mm
Number of pins: 4
Current rating: 10A
Electrical life: 100000 cycles
Contact material: AgSnO
на замовлення 250 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
63+109.40 грн
Мінімальне замовлення: 63 шт
В кошику  од. на суму  грн.
G5LE-14-DC24 en-g5le.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VDC; SPDT; Icontacts max: 10A
Type of relay: electromagnetic
Coil voltage: 24V DC
Contacts configuration: SPDT
Contact current max.: 10A
Manufacturer series: G5LE
Switched voltage: max. 250V AC
Relay variant: monostable; power
Mounting: THT
Coil resistance: 1.44kΩ
Operate time: 10ms
Release time: 5ms
Coil power consumption: 400mW
Coil current: 16.7mA
Operating temperature: -25...85°C
Height: 19mm
Contact material: AgSnO
Current rating: 10A
Leads: for PCB
Electrical life: 100000 cycles
на замовлення 2313 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
48+150.42 грн
250+110.89 грн
500+102.43 грн
Мінімальне замовлення: 48 шт
В кошику  од. на суму  грн.
G5LE-14-DC36 en-g5le.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 36VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPDT
Coil voltage: 36V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: THT
Coil resistance: 3.24kΩ
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil current: 11.1mA
Leads: for PCB
Height: 19mm
Contact material: AgSnO
Current rating: 10A
на замовлення 175 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
47+155.89 грн
Мінімальне замовлення: 47 шт
В кошику  од. на суму  грн.
G5LE-14-DC6 en-g5le.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 6VDC; Icontacts max: 10A; G5LE
Type of relay: electromagnetic
Contacts configuration: SPDT
Coil voltage: 6V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable
Mounting: THT
Coil resistance: 90Ω
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 66.7mA
Operating temperature: -25...85°C
Leads: for PCB
Height: 19mm
Contact material: AgSnO
Number of pins: 5
Current rating: 10A
на замовлення 395 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
55+132.19 грн
350+94.81 грн
Мінімальне замовлення: 55 шт
В кошику  од. на суму  грн.
G5LE-1A4-DC48
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPST-NO; Ucoil: 48VDC; Icontacts max: 10A
Type of relay: electromagnetic
Contacts configuration: SPST-NO
Coil voltage: 48V DC
Contact current max.: 10A
Manufacturer series: G5LE
Mounting: THT
Coil resistance: 5.76kΩ
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 8.3mA
Operating temperature: -25...85°C
Leads: for PCB
Electrical life: 100000 cycles
Height: 19mm
Contact material: AgSnO
Number of pins: 4
Current rating: 10A
на замовлення 500 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
5+1446.75 грн
25+1208.82 грн
Мінімальне замовлення: 5 шт
В кошику  од. на суму  грн.
G5LE-1 DC9 en-g5le.pdf
Виробник: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; SPDT; Ucoil: 9VDC; Icontacts max: 10A; G5LE
Type of relay: electromagnetic
Contacts configuration: SPDT
Coil voltage: 9V DC
Contact current max.: 10A
Manufacturer series: G5LE
Relay variant: monostable; power
Mounting: THT
Coil resistance: 200Ω
Operate time: 10ms
Body dimensions: 22.5x15.6x19mm
Release time: 5ms
Coil power consumption: 400mW
Coil current: 45mA
Operating temperature: -25...85°C
Leads: for PCB
Electrical life: 100000 cycles
Height: 19mm
Contact material: AgSnO
Current rating: 10A
на замовлення 800 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
40+179.59 грн
365+144.75 грн
730+138.83 грн
Мінімальне замовлення: 40 шт
В кошику  од. на суму  грн.
LY2N 24VAC
LY2N 24VAC
Виробник: OMRON
Category: Industrial Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 24VAC; DPDT; Icontacts max: 10A
Type of relay: electromagnetic
Coil voltage: 24V AC
Contacts configuration: DPDT
Contact current max.: 10A
AC contacts rating @R: 10A / 110V AC
DC contacts rating @R: 10A / 24V DC
Switched voltage: max. 125V DC; max. 250V AC
Relay variant: industrial
Mounting: socket
Manufacturer series: LY2
Body dimensions: 28x21.5x36mm
Coil resistance: 180Ω
Mechanical durability: 100000000 cycles
Operate time: 25ms
Release time: 25ms
Switching capacity: 240W; 1100VA
Contact resistance: 50mΩ
Coil power consumption: 0.9W
Leads: connectors
Leads dimensions: 4.8x0.5mm
Operating temperature: -25...40°C
Indication: LED
Coil voltage min.: 19.2V AC
Related items: PT08-0; PTF08A-E; PTFZ-08-E
на замовлення 30 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+953.56 грн
5+805.03 грн
10+764.40 грн
В кошику  од. на суму  грн.
LY2N 220/240VAC ly.pdf
LY2N 220/240VAC
Виробник: OMRON
Category: Industrial Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 230VAC; DPDT; Icontacts max: 10A
Type of relay: electromagnetic
Coil voltage: 230V AC
Contacts configuration: DPDT
Contact current max.: 10A
AC contacts rating @R: 10A / 110V AC
DC contacts rating @R: 10A / 24V DC
Switched voltage: max. 125V DC; max. 250V AC
Relay variant: industrial
Mounting: socket
Manufacturer series: LY2
Body dimensions: 28x21.5x36mm
Coil resistance: 18.79kΩ
Mechanical durability: 50000000 cycles
Operate time: 25ms
Release time: 25ms
Switching capacity: 240W; 1100VA
Contact resistance: 50mΩ
Coil power consumption: 1.2VA
Leads: connectors
Leads dimensions: 4.8x0.5mm
Operating temperature: -25...40°C
Indication: LED
Coil voltage min.: 192V AC
Related items: PT08-0; PTF08A-E; PTFZ-08-E
на замовлення 187 шт:
термін постачання 14-30 дні (днів)
КількістьЦіна без ПДВ
1+1321.86 грн
5+883.76 грн
25+852.44 грн
В кошику  од. на суму  грн.
D4NL-4AFA-BS D4NL_EN.pdf D4NL_DE.pdf
D4NL-4AFA-BS
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC + NO; IP67; Electr.connect: M20
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC + NO
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4EFA-B D4NL_EN.pdf D4NL_DE.pdf
D4NL-4EFA-B
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x2 + NO; IP67; plastic; black/red
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x2 + NO
Safety switches features: LED status indicator; no key; power to release
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4EFG-B D4NL_EN.pdf D4NL_DE.pdf
D4NL-4EFG-B
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x2 + NO; IP67; plastic; black/red
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x2 + NO
Safety switches features: LED status indicator; no key; power to lock
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4DFA-B D4NL_EN.pdf D4NL_DE.pdf
D4NL-4DFA-B
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x2; Number of key entry slots: 4
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x2
Safety switches features: LED status indicator; no key; power to release
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC x2
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4ADA-B D4NL_EN.pdf D4NL_DE.pdf
D4NL-4ADA-B
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC + NO; IP67; Electr.connect: M20
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC + NO
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC + NO
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4HFG-B D4NL_EN.pdf D4NL_DE.pdf
D4NL-4HFG-B
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x3; Number of key entry slots: 4
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x3
Safety switches features: LED status indicator; no key; power to lock
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Contacts electrical parameters: 240V AC / 3A
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC x2
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
D4NL-4HFA-B4 D4NL_EN.pdf D4NL_DE.pdf
D4NL-4HFA-B4
Виробник: OMRON
Category: Standard Safety Switches
Description: Safety switch: bolting; D4NL; NC x3; Number of key entry slots: 4
Type of safety switch: bolting
Manufacturer series: D4NL
Contacts configuration: NC x3
Safety switches features: LED status indicator; power to release
Number of key entry slots: 4
IP rating: IP67
Electrical connection: M20
Body material: plastic
Colour: black/red
Supply voltage: 24V DC
Mechanical durability: 1000000 cycles
Operating temperature: -10...55°C
Related items: D4DS-K1; D4DS-K2; D4DS-K3; D4DS-K5
Integrated auxiliary contacts: NC x2
Dimensions: 35.5x88.5x95mm
товару немає в наявності
В кошику  од. на суму  грн.
Обрати Сторінку:   [  << Попередня Сторінка ]  1 45 90 135 180 225 270 315 360 405 407 408 409 410 411 412 413 414 415 416 417 450 454  [ Наступна Сторінка >> ]